SecReT6
Protein ID: 537437146
SecReT6 ID842
T6SS typei1
Gene symbol-
Locus tagSPUCDC_1893
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
Repliconchromosome [GenBank: NC_022221] [Browse all T6SS(s) in this replicon]
Location [Strand]1885678..1887531 [+]
Producthypothetical protein
NoteTssF
UniProt IDT1YIH1
KEGG IDsega:SPUCDC_1893
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-191, Aligned region: 5..617
Protein Sequence: 617 a.a.     [Download]
>gi|537437146|ref|YP_008481523.1| hypothetical protein SPUCDC_1893 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67]
MEFEERYYRQELDHLRQLSKLLATEKPHLARFLAEKEADPDIERLLEGVAFLTGNLRQKIEDEFPELTHG
LIRMLWPNYLRPVPSMTLIEYTPDMDKTSVPVLIPRNEQFTTGAKGTQGNPVLSAYSGNEHDVAPPCTFT
LCRDIWLLPVQLDQVENRSTPRHGIIDITFAVAPGTDFATLDLNRLRFWLGNDDNYTRYQLYLWFCEYLQ
GAELMAGGQSIPMPEFMLKAVGFESEDAMLPWPGNVHSGYRILQEFFCYADSFLFFDACGIPALPDRLKE
NRFTLRLRFSRPLPADIRLRDDSLRLYCAPAINLFSHHAEAITLDHQRQDYALVPSRHFPDHYDIFSVNS
VVSQTQGKQRKADLGRPVITEAARHWPAFESFRHQMEYSRKREVVYWQHRTRTSLFHRGFDHTLAFIHAD
GSLPDASLLNNEVVSVSLTCTNRELPVQLRPGDITGTTGKNASVASFRNITRPTRPLWPVIDGSLHWSLL
SAMNLNYLSLLDADALKQVIANFDRHAIHHPQMARLSQQKLDAIERLETTPVDRLFTGIPVRGLASTLSI
HTEPFVCEGEMYLLGAVLSHFLSLYAIVNSFHMLTVVNTESQESWKWAERTGQHPLI
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|537435369|ref|NC_022221.1|:1885678-1887531 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67, complete genome
ATGGAATTCGAAGAACGCTATTACAGGCAGGAGTTGGATCACCTGCGGCAGTTGAGCAAGCTGCTGGCGA
CCGAAAAGCCGCATCTGGCCCGGTTTCTGGCAGAAAAAGAGGCCGATCCGGATATCGAGCGTCTGCTGGA
GGGCGTGGCCTTTCTGACCGGCAATCTGCGCCAGAAAATCGAGGATGAGTTTCCGGAGCTGACGCACGGA
CTGATCCGGATGCTGTGGCCCAATTATCTGCGCCCGGTGCCGTCGATGACGCTGATTGAATATACGCCGG
ATATGGATAAAACTTCCGTGCCGGTACTGATCCCCCGTAATGAGCAGTTCACAACCGGGGCGAAGGGGAC
TCAGGGAAACCCGGTATTGTCTGCGTATTCCGGCAATGAGCACGATGTAGCCCCGCCCTGTACGTTCACC
CTGTGCCGGGATATCTGGCTGTTACCCGTTCAACTGGATCAGGTTGAAAATCGCAGTACGCCCCGCCACG
GCATTATTGATATTACGTTTGCCGTCGCACCGGGCACTGATTTTGCCACGCTGGATCTGAACAGGCTGCG
CTTCTGGCTGGGCAACGATGATAACTATACCCGCTATCAGCTTTATCTGTGGTTTTGTGAATATTTACAG
GGCGCAGAGTTGATGGCGGGCGGGCAGTCGATCCCGATGCCTGAATTTATGCTGAAAGCGGTGGGTTTTG
AGTCAGAGGACGCCATGCTGCCCTGGCCCGGCAATGTCCACAGCGGCTACCGCATTCTCCAGGAGTTTTT
CTGCTACGCCGACAGTTTTCTGTTTTTCGATGCCTGTGGCATTCCGGCATTGCCAGACAGGTTAAAGGAG
AACCGTTTCACTCTGCGGCTGCGGTTTTCTCGCCCCTTACCGGCAGATATCCGGCTGCGGGATGATTCCC
TGCGCTTATATTGTGCGCCCGCCATTAATCTGTTTTCCCACCATGCCGAAGCCATCACGCTGGATCATCA
GCGGCAGGATTACGCTCTGGTTCCCAGCCGTCATTTTCCGGATCATTACGACATTTTTTCGGTTAACAGC
GTGGTGAGTCAGACGCAGGGGAAGCAGAGAAAAGCGGATCTTGGACGGCCGGTGATCACAGAGGCCGCGC
GCCACTGGCCTGCTTTTGAGAGTTTCCGCCACCAGATGGAGTACAGCCGTAAGCGGGAAGTGGTCTACTG
GCAGCACCGGACCAGGACCTCGCTGTTTCACCGGGGCTTTGATCATACCCTGGCTTTTATTCATGCCGAT
GGCAGCCTCCCGGATGCCTCACTGCTTAATAATGAAGTGGTTTCTGTATCGCTGACCTGCACCAACCGGG
AGCTGCCGGTACAGCTACGGCCCGGCGATATCACCGGTACGACAGGTAAAAACGCGTCGGTGGCGTCATT
TCGCAATATCACCCGCCCCACCAGACCGCTCTGGCCGGTGATTGACGGCAGCCTGCACTGGTCGTTGCTG
TCTGCCATGAACCTGAATTATCTGTCGTTGCTGGATGCTGATGCGCTCAAACAGGTGATCGCCAATTTTG
ATCGCCACGCCATCCATCATCCGCAGATGGCCCGTCTGTCACAGCAGAAGCTGGACGCCATTGAACGGCT
GGAAACAACCCCGGTTGATCGCCTGTTTACCGGCATACCGGTGCGCGGGCTGGCGTCCACCCTGTCCATT
CATACGGAGCCGTTTGTCTGCGAGGGTGAAATGTACCTGCTGGGCGCGGTGCTGTCGCATTTTCTGTCGC
TGTACGCCATCGTCAATTCGTTCCACATGCTGACCGTCGTTAACACGGAAAGCCAGGAGTCATGGAAATG
GGCGGAAAGAACCGGGCAACACCCGCTCATCTGA
 Primer design