SecReT6
Protein ID: 537437151
SecReT6 ID842
T6SS typei1
Gene symbol-
Locus tagSPUCDC_1898
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
Repliconchromosome [GenBank: NC_022221] [Browse all T6SS(s) in this replicon]
Location [Strand]1891763..1892512 [+]
Producthypothetical protein
NoteTssL
UniProt IDT1YIH3
KEGG IDsega:SPUCDC_1898
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-59, Aligned region: 30..231
Protein Sequence: 249 a.a.     [Download]
>gi|537437151|ref|YP_008481528.1| hypothetical protein SPUCDC_1898 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67]
MDELSLPPLPGYEREGQRQYQLALRGNSLNPMIDAATPLLGMVMRVSGMNSHAMPEHLFTQVVTDVQAVE
QLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLMSEPK
RYQDLLEFLYICFSLGFRGRAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLIKRLTI
RHVLCGGIVVLALFYLFYLLRLDSQTQDILHQLNRLLAR
 
Nucleotide Sequence: 750 bp     [Download]
>gi|537435369|ref|NC_022221.1|:1891763-1892512 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67, complete genome
ATGGATGAGCTGTCACTGCCCCCTTTACCCGGATACGAGAGAGAAGGCCAGCGCCAGTATCAGCTGGCGC
TGCGCGGCAACAGCCTGAACCCGATGATCGATGCCGCCACCCCGCTGCTGGGGATGGTGATGCGCGTTTC
GGGCATGAACAGCCATGCCATGCCTGAACACCTGTTCACCCAGGTGGTGACGGATGTGCAGGCGGTGGAG
CAGTTACTCCAGGAGCAGGGCTATGAGCCTGGGGTGATTATCTCGTTTCGTTACATCCTGTGTACCTTTA
TTGACGAGGCGGCGCTGGGGAATGGCTGGTCGAACAAAAACGAGTGGATCAAGCAGTCGCTGCTGGTGCA
TTTCCATAACGAAGCCTGGGGCGGTGAAAAGGTTTTTATCCTGCTGGAGCGCCTGATGAGCGAACCCAAA
CGCTACCAGGATCTGCTGGAATTTTTGTACATCTGCTTTTCGCTGGGCTTTCGCGGGCGCGCCGTCCAGG
ACCAGGGGGAGTTTGAGCAGATATACCGCCGCCTGTATCACGTCCTGCATAAGCTGCGCGGCGATGCGCC
CTTTCCGCTGCTGCACCAGGATAAAAAAACCCAGGGCGGGCGCTATCAGCTGATTAAACGGCTGACCATC
CGGCATGTTCTGTGCGGCGGCATCGTCGTACTGGCGCTGTTTTATCTGTTTTATCTGCTGCGTCTGGACA
GTCAGACGCAGGACATTCTTCATCAGTTAAACCGGCTGCTTGCCAGGTAA
 Primer design