SecReT6
Protein ID: 537437152
SecReT6 ID842
T6SS typei1
Gene symbol-
Locus tagSPUCDC_1899
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
Repliconchromosome [GenBank: NC_022221] [Browse all T6SS(s) in this replicon]
Location [Strand]1892525..1895116 [+]
Productputative clpB-protease
NoteTssH
UniProt IDT1YHC3
KEGG IDsega:SPUCDC_1899
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.60E-39, Aligned region: 262..262
AAA_2 [PF07724], Evalue: 8.60E-39, Aligned region: 606..767
AAA [PF00004], Evalue: 2.40E-17, Aligned region: 30..57
AAA [PF00004], Evalue: 2.40E-17, Aligned region: 223..327
AAA [PF00004], Evalue: 2.40E-17, Aligned region: 612..730
AAA_5 [PF07728], Evalue: 4.20E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 4.20E-14, Aligned region: 611..732
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 24..75
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 441..462
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 586..652
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 677..705
ClpB_D2-small [PF10431], Evalue: 8.30E-10, Aligned region: 762..825
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 25..66
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 610..645
AAA_25 [PF13481], Evalue: 2.20E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 2.20E-05, Aligned region: 282..307
AAA_25 [PF13481], Evalue: 2.20E-05, Aligned region: 606..640
AAA_25 [PF13481], Evalue: 2.20E-05, Aligned region: 673..694
AAA_14 [PF13173], Evalue: 3.80E-05, Aligned region: 222..304
AAA_14 [PF13173], Evalue: 3.80E-05, Aligned region: 611..701
NACHT [PF05729], Evalue: 0.00011, Aligned region: 222..250
NACHT [PF05729], Evalue: 0.00011, Aligned region: 411..445
NACHT [PF05729], Evalue: 0.00011, Aligned region: 612..640
AAA_29 [PF13555], Evalue: 0.00019, Aligned region: 215..239
AAA_29 [PF13555], Evalue: 0.00019, Aligned region: 609..636
DUF258 [PF03193], Evalue: 0.00025, Aligned region: 191..239
DUF258 [PF03193], Evalue: 0.00025, Aligned region: 612..630
AAA_19 [PF13245], Evalue: 0.00027, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00027, Aligned region: 603..633
Clp_N [PF02861], Evalue: 0.00098, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.00098, Aligned region: 117..123
AAA_18 [PF13238], Evalue: 0.0036, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0036, Aligned region: 612..648
Arch_ATPase [PF01637], Evalue: 0.0052, Aligned region: 202..236
Arch_ATPase [PF01637], Evalue: 0.0052, Aligned region: 275..308
Arch_ATPase [PF01637], Evalue: 0.0052, Aligned region: 612..632
Arch_ATPase [PF01637], Evalue: 0.0052, Aligned region: 682..693
Zeta_toxin [PF06414], Evalue: 0.0052, Aligned region: 222..241
Zeta_toxin [PF06414], Evalue: 0.0052, Aligned region: 610..651
AAA_17 [PF13207], Evalue: 0.0062, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0062, Aligned region: 612..646
Protein Sequence: 863 a.a.     [Download]
>gi|537437152|ref|YP_008481529.1| putative clpB-protease [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67]
MIQIDLATLVKRLAPFAKQALEAAASECMSQQAAEITVAHVLLQMLATPRSDFRVIAERAEIGADDLRQA
LTVENYATARSSDSYPSFSPMLVEWLKEAWLLASAEMQQTELRGGVLLLALLHSPLRYLPPAAARLLTAI
NRDLLRQDFAGWTKESAESVILNADGQTASAIADTGDTLLARYAKNMTDDARQGRLDPVLCRDNEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIIAGQVPDKLRDTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVIQSPKPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDSGLSA
VYEQSHGVLIDDEALQAAATLSERYLSGRQLPDKAIDVLDTACARVAINLSSPPRQISALTTLRQQCEAE
IRQLEREIRIGLRSDTSRLNEVLAQYDETLSELDALEAAWRQQQTLVQEIIALRKGLLDETDATGNDETA
TPETEAVGSDDESVTAPPEAEPEISPAARLAQLTAELDALHHTQLLVSPHVDKKQIASVIAEWTGVPLNR
LSQNEMSVITDLPQWLGDTIKGQALAIKHLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAE
LLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLF
YQAFDKGEMADGEGRLIDCKNVVFFLTSNLGYQVIVEHADNPEAMQEALYPVLADFFKPALLARLDNVLR
ARFGAEVVIEPEVTDEIMQRVTRAENGARMLESVIDGEMLPPLSLLLLQKMAANIAIARITLGVANGAFT
ADVEDVPDEDTQPVAEAEDEAVL
 
Nucleotide Sequence: 2592 bp     [Download]
>gi|537435369|ref|NC_022221.1|:1892525-1895116 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67, complete genome
ATGATCCAGATTGACTTAGCCACCCTGGTAAAACGGCTTGCTCCCTTCGCGAAACAGGCGCTGGAAGCGG
CGGCGTCGGAGTGTATGAGCCAGCAGGCGGCAGAAATTACCGTCGCGCATGTGCTGCTACAGATGCTGGC
GACCCCGCGCAGCGACTTTCGGGTGATTGCCGAACGTGCGGAGATCGGCGCCGATGATTTACGCCAGGCG
CTGACGGTGGAAAATTACGCCACCGCCCGTTCATCCGACAGCTACCCGTCGTTTTCCCCGATGCTGGTTG
AATGGCTGAAAGAGGCCTGGCTGCTGGCCTCCGCGGAAATGCAGCAGACCGAACTGCGCGGCGGCGTGCT
GCTGCTCGCCCTGCTGCATTCGCCGTTGCGCTACCTGCCGCCCGCCGCCGCCCGGTTGCTGACCGCCATC
AACCGCGACCTGCTCCGGCAGGATTTTGCCGGGTGGACGAAGGAGTCCGCCGAATCGGTGATCCTGAATG
CGGACGGACAGACCGCCAGCGCCATAGCCGATACCGGCGACACCCTGCTGGCCCGCTATGCCAAAAACAT
GACCGACGATGCCCGGCAGGGGCGGCTTGATCCGGTGCTGTGCCGCGATAACGAAATTGACCTGATGATC
GATATCCTCTGCCGCCGCCGTAAAAATAATCCGGTGGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATTATTGCCGGTCAGGTGCCGGACAAACTGCGCGATACCGATATTAT
GACGCTGGATCTCGGCGCATTACAGGCGGGCGCGTCGGTGAAAGGTGAATTTGAGAAGCGCTTTAAGGGG
CTGATGGCGGAAGTCATTCAGTCGCCGAAACCCGTCATCCTGTTTATCGACGAAGCCCACACGCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCACTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAATACAAAAAATACTTCGAGAAAGACTCCGGCCTGTCGGCG
GTGTATGAGCAGTCCCACGGCGTGCTGATTGACGATGAAGCCTTACAGGCCGCTGCGACGTTGAGCGAGC
GCTACCTGTCAGGCCGCCAGTTGCCGGATAAGGCCATTGATGTGCTGGATACCGCCTGCGCCCGCGTGGC
GATTAACCTCTCCTCGCCGCCGAGACAAATCTCGGCGCTGACCACCCTGCGCCAGCAGTGTGAAGCGGAA
ATCCGCCAGCTTGAGCGTGAGATCCGTATTGGCCTGCGGTCGGACACCTCACGGCTAAACGAGGTTCTGG
CGCAGTATGACGAAACGCTGAGCGAACTGGATGCGCTGGAGGCCGCGTGGCGCCAGCAGCAGACGCTGGT
GCAGGAGATTATCGCGCTGCGTAAGGGGCTGCTGGACGAAACGGACGCTACCGGCAACGACGAAACCGCA
ACGCCTGAAACAGAGGCGGTGGGCAGTGACGATGAATCCGTCACAGCGCCGCCGGAAGCGGAACCGGAAA
TTTCGCCAGCCGCCCGCCTCGCGCAGCTCACCGCCGAACTGGACGCCCTGCACCACACGCAGCTGCTGGT
CTCCCCACACGTCGATAAAAAACAGATAGCCAGCGTGATTGCCGAATGGACCGGCGTGCCGCTTAACCGC
CTGTCACAAAACGAAATGTCGGTCATCACCGACCTGCCGCAGTGGCTGGGCGACACCATTAAAGGCCAGG
CGCTGGCGATTAAGCACCTGCACAAACACCTGCTGACCGCCCGCGCCGATCTGCGCCGTCCGGGACGCCC
GCTCGGCGCGTTCCTGCTGGCCGGTCCCAGCGGTGTCGGCAAAACCGAAACCGTGCTGCAACTGGCCGAA
CTGCTCTACGGCGGTCGCCAGTACCTGACCACCATCAATATGTCGGAGTTTCAGGAGAAACACACCGTTT
CACGCCTGATTGGTTCGCCGCCGGGCTATGTCGGCTACGGCGAGGGCGGCGTGCTGACCGAAGCGATTCG
TCAGAAACCGTACTCCGTGGTGCTGCTCGACGAGGTGGAGAAAGCCCACCCGGACGTGCTCAACCTGTTC
TACCAGGCGTTCGACAAGGGCGAGATGGCCGATGGCGAAGGGCGTCTTATCGACTGTAAAAATGTGGTGT
TCTTCCTCACCTCCAACCTCGGCTATCAGGTGATTGTCGAACATGCCGACAACCCGGAAGCCATGCAGGA
AGCGCTGTACCCGGTACTGGCGGACTTCTTTAAACCGGCGCTGCTGGCGCGGCTGGACAACGTACTGCGC
GCCCGCTTCGGCGCGGAGGTGGTGATTGAGCCGGAGGTGACCGACGAAATCATGCAGCGCGTCACCCGCG
CCGAAAACGGCGCGCGGATGCTGGAGTCGGTCATCGACGGCGAGATGCTGCCGCCGCTCTCCCTGCTGCT
GTTGCAGAAAATGGCGGCGAATATCGCCATTGCCCGTATCACGCTGGGCGTGGCAAACGGCGCGTTTACC
GCGGATGTGGAGGATGTGCCGGATGAGGATACTCAGCCCGTAGCGGAAGCAGAGGACGAAGCCGTTCTAT
GA
 Primer design