SecReT6
Protein ID: 537437154
SecReT6 ID842
T6SS typei1
Gene symbol-
Locus tagSPUCDC_1901
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
Repliconchromosome [GenBank: NC_022221] [Browse all T6SS(s) in this replicon]
Location [Strand]1895969..1897264 [+]
Producthypothetical protein
NoteTssA
UniProt IDT1YJA0
KEGG IDsega:SPUCDC_1901
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.40E-09, Aligned region: 13..70
Protein Sequence: 431 a.a.     [Download]
>gi|537437154|ref|YP_008481531.1| hypothetical protein SPUCDC_1901 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67]
MLKLGSLAHSQLDIPEIQRRGLVILASESKDFRLLAHLLRTLQHAGDPLLALRLLALYVEHYWTVAAPQN
AAHKQRFATQVLKRFETGVESFAETARTAQRDSLLAELAKLAQRWQEQNIPALAQAVDDLSSQYRRAFRG
AAPVPPAAGPSTPPAPVSATPSAPVSPSAPAATTAPPVDIDSHDDKAWRDTLLKVAAILCERQPDSPQGY
RLRRHALWQAITSVPQAESDGRTPLAAVPADMTADYQARLNNADLALWQQVEKSLLLAPYWLDGHYLSAQ
AAQRLGYTSAAEAIRDEVVRFLARLPQLATLLFNDRTPFISEQTKQWLAASPGSQTAPMVRTSEDTEAVR
QCFSEQGLEATLRYLETLPEGDPRDRFHRQYLGAQLLEEAGMAQLAQQQYRMLFKAGLRMTLAEWEPSLL
EQLENKLTAEQ
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|537435369|ref|NC_022221.1|:1895969-1897264 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67, complete genome
ATGCTTAAACTCGGCTCGCTGGCGCACAGTCAGCTGGATATCCCGGAAATTCAGCGCCGGGGGCTGGTGA
TTCTGGCCTCGGAAAGCAAGGATTTTCGCCTGCTGGCCCATCTGCTGCGCACCCTGCAACATGCCGGCGA
TCCGCTGCTGGCGCTGCGTCTGCTGGCGCTGTACGTGGAGCATTACTGGACGGTGGCGGCACCACAAAAT
GCGGCACATAAACAGCGTTTCGCCACCCAGGTGCTGAAACGCTTTGAAACCGGCGTGGAGAGTTTCGCAG
AGACAGCCCGTACCGCGCAGCGCGACAGCCTGCTGGCTGAACTGGCGAAACTGGCGCAGCGCTGGCAGGA
GCAGAATATCCCGGCGCTGGCACAGGCCGTCGATGACCTCTCGTCGCAGTATCGCCGGGCATTTCGCGGG
GCCGCCCCGGTGCCGCCAGCGGCTGGCCCGTCCACGCCTCCGGCTCCGGTTTCGGCCACGCCGTCCGCCC
CGGTATCCCCGTCTGCGCCTGCGGCGACGACGGCGCCACCGGTGGATATCGACAGCCATGACGACAAAGC
CTGGCGCGACACGCTGCTGAAAGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGATTCACCGCAGGGCTAC
CGCCTGCGCCGCCATGCGTTATGGCAGGCCATTACATCCGTCCCCCAGGCCGAAAGCGACGGGCGCACAC
CGCTGGCGGCGGTGCCTGCCGACATGACCGCCGATTACCAGGCGCGGCTGAACAACGCCGATCTGGCGCT
CTGGCAACAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTCGATGGTCATTACCTTTCAGCGCAG
GCCGCACAACGCCTGGGCTACACCAGCGCGGCAGAAGCCATCCGGGATGAGGTGGTTCGCTTTCTCGCCC
GCCTGCCGCAACTTGCCACCCTGCTGTTTAATGACCGCACACCGTTTATCAGCGAACAGACAAAACAGTG
GCTGGCGGCGTCTCCGGGCAGTCAGACAGCCCCGATGGTGCGGACCAGTGAAGACACCGAGGCCGTCCGC
CAGTGTTTCAGCGAGCAGGGGCTGGAGGCCACGCTGCGATACCTGGAAACCCTGCCGGAAGGCGATCCGC
GCGATCGGTTCCACCGGCAGTATCTTGGCGCGCAACTGTTAGAAGAAGCCGGGATGGCGCAACTGGCACA
GCAACAGTACCGGATGTTGTTTAAAGCAGGGCTGCGCATGACGCTGGCTGAATGGGAGCCGTCCCTGCTG
GAACAACTGGAAAACAAACTCACGGCAGAACAGTAA
 Primer design