SecReT6
Protein ID: 537437155
SecReT6 ID842
T6SS typei1
Gene symbol-
Locus tagSPUCDC_1902
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
Repliconchromosome [GenBank: NC_022221] [Browse all T6SS(s) in this replicon]
Location [Strand]1897343..1900804 [+]
Producthypothetical protein
NoteTssM
UniProt IDT1YK25
KEGG IDsega:SPUCDC_1902
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.50E-81, Aligned region: 297..342
IcmF-related [PF06761], Evalue: 1.50E-81, Aligned region: 484..797
ImcF-related_N [PF14331], Evalue: 1.00E-59, Aligned region: 185..431
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 893..1012
AAA_22 [PF13401], Evalue: 0.00048, Aligned region: 120..252
AAA_22 [PF13401], Evalue: 0.00048, Aligned region: 640..662
AAA_22 [PF13401], Evalue: 0.00048, Aligned region: 835..866
AAA_19 [PF13245], Evalue: 0.007, Aligned region: 120..133
AAA_19 [PF13245], Evalue: 0.007, Aligned region: 257..285
Protein Sequence: 1153 a.a.     [Download]
>gi|537437155|ref|YP_008481532.1| hypothetical protein SPUCDC_1902 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67]
MPRFKVSAAWLLALAWILLLVWIWWKGPSWTLYEQRWLAPLANRWLATAAWGLIALTWLTVRVMKRLQLL
EKQQRQQRDEAQDPLSVELNTQQRYLDHWLLRLQRHLDSRRYLWQLPWYMVTGPAGSGKTTLLREGYPSD
IIYAPEALRGVEQRRYVIPHVGKQAVIFDADGLLFEQQDADILHRRLWTHMLDWLAQKRARQPLNGLILT
LDLPDLLTADKPRREHLLQILRGRLQDIRQHLHCQLPVYVVLTRLDLLHGFAALFQSLDRNDRDAILGVT
FTRHAHENDDWRTELNAFWQTWGEQLNNVLPERMLAPGSRSSLFSFVRQIQGGREPLIALLNGLLDGENM
DVMLRGVYLTSSLQRGQIDDIFMQSAARQFRLGSSPLTAWPLVDTLPYFTRNLFPQTLLAEPNLASESRV
WLMQSRRRLSVFSATGGIAALLLIIGWHHYYNNNWRSGITVLEQAKAFMSVPPPQGMDDYGNLQLPLLNP
VRDATLAYGDWGDRSRLADMGLYQGRRVGPYVEQTYLQLLEQRYLPALFNGLVKEMNAAPAESEEKLAVL
RVIRMLEDKSGRSDEVVKQYMAKRWSDKFHGQRDIQAQLMSHLDYALKHTDWHAERQAGDGDAISRWTPY
DNPVVAAQKELSKLPVYQRVYQSLKTRAMGVLPADLNLRDQVGATFDQVFTSGDDNKLIVPQFLTRYGLQ
SYFVKQRDALIELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYLSDYTATWSAGMDNLNVRNYESIAQ
LTGALEQIISGDQPLQRALTALRDNTQPAVLSEKLDDKALQEAMAEPDYQLLTRLGHEFAPENSTLAVQK
DKENTLQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGKL
ADQAWHVVMVEAVHYMEVDWRDNVVKPFNEQLADNYPFNPRSQSDASLDAFERFFKPNGVLDTFYQQNLR
LFMENDLSLEDGDNNVIIREDVREQLDTAQEIREAFFSRQNGLGAQFAVETVSLSGNKRRSVLNLDGQLV
DYSQGRNYTAHLVWPNNMREGNESKLTLIGVSGGAPRSISFSGPWAQFRLFGAGQLTGVQEGTFSVRFNV
DGGAMVYRVHTDTEDNPFTGGLFSQFRLPDTLY
 
Nucleotide Sequence: 3462 bp     [Download]
>gi|537435369|ref|NC_022221.1|:1897343-1900804 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67, complete genome
ATGCCCCGGTTTAAGGTTTCTGCCGCCTGGCTGCTGGCGCTGGCGTGGATTTTGCTGCTGGTATGGATCT
GGTGGAAAGGTCCGTCATGGACGCTCTACGAGCAGCGCTGGCTGGCCCCGCTGGCGAACCGCTGGCTGGC
CACCGCCGCCTGGGGGTTGATTGCGCTGACGTGGCTGACCGTCCGGGTCATGAAGCGCCTGCAACTGCTG
GAAAAACAGCAGCGCCAGCAACGGGACGAGGCGCAGGATCCGCTCAGCGTGGAACTGAACACCCAGCAAC
GCTATCTCGATCACTGGTTACTGCGTCTGCAACGCCATCTCGACAGCCGCCGCTATCTGTGGCAGCTACC
GTGGTATATGGTCACTGGCCCGGCGGGAAGCGGTAAAACCACGCTGCTGCGCGAAGGGTATCCGTCCGAC
ATTATTTATGCCCCGGAGGCGCTGCGGGGCGTGGAGCAGCGCCGGTATGTTATCCCGCATGTGGGAAAAC
AGGCGGTGATTTTTGACGCTGACGGCCTCCTCTTTGAGCAACAGGATGCGGATATACTGCATCGCCGCCT
GTGGACCCATATGCTGGACTGGCTGGCGCAAAAACGCGCCCGGCAGCCGCTGAACGGCCTGATACTGACG
CTGGATCTGCCCGATCTTCTGACCGCCGACAAGCCACGCCGTGAGCACCTGTTGCAGATCCTGCGCGGAC
GTTTGCAGGATATACGCCAGCATCTTCACTGCCAGCTCCCCGTCTATGTGGTGCTGACCCGGCTGGATCT
ACTGCACGGTTTCGCCGCCCTGTTTCAGTCACTGGACCGCAACGATCGCGACGCCATTCTTGGCGTCACC
TTTACCCGTCATGCCCATGAAAATGACGACTGGCGTACAGAACTGAATGCCTTCTGGCAGACATGGGGCG
AACAGTTGAATAACGTCCTGCCGGAGCGGATGTTAGCCCCCGGCTCCCGCAGTTCCCTGTTCAGCTTTGT
CCGCCAGATCCAGGGGGGCCGCGAGCCGCTGATCGCCCTGCTGAACGGGCTGCTGGACGGGGAAAATATG
GATGTGATGCTGCGCGGCGTGTACCTCACCTCCTCCCTGCAACGCGGCCAGATAGACGATATTTTTATGC
AGTCCGCCGCCCGTCAGTTCCGGCTGGGCAGCAGTCCGCTGACCGCCTGGCCGCTGGTGGACACGTTACC
GTATTTCACCCGTAATCTGTTTCCGCAGACCTTACTGGCTGAGCCGAACCTCGCCAGTGAAAGCCGCGTC
TGGCTGATGCAGTCCCGCCGCCGGTTGTCCGTGTTTTCCGCCACTGGCGGCATCGCCGCCCTGCTGCTGA
TTATCGGCTGGCATCACTATTACAATAACAACTGGCGTTCCGGCATCACCGTACTGGAGCAGGCCAAAGC
TTTTATGTCGGTTCCGCCACCGCAGGGTATGGACGATTATGGCAACCTGCAACTACCGTTACTTAACCCG
GTGCGTGACGCCACGCTGGCCTACGGCGACTGGGGCGATCGCAGTCGTCTGGCCGATATGGGATTATATC
AGGGCAGGCGTGTCGGCCCATATGTGGAGCAGACCTACCTGCAACTGCTGGAGCAGCGTTACCTGCCCGC
CCTGTTTAACGGCCTGGTCAAAGAGATGAATGCCGCGCCTGCGGAGAGCGAGGAGAAGCTCGCGGTATTG
CGCGTTATCAGAATGCTGGAAGATAAAAGCGGACGCAGCGACGAGGTGGTGAAGCAGTATATGGCGAAAC
GCTGGAGCGATAAATTTCACGGCCAGCGCGATATTCAGGCACAGCTAATGTCTCATCTGGACTACGCGCT
GAAACACACCGACTGGCACGCGGAGCGTCAGGCAGGCGACGGCGACGCCATCAGCCGCTGGACGCCGTAT
GACAATCCGGTCGTGGCGGCGCAGAAAGAGCTCAGCAAACTGCCCGTCTACCAGCGCGTTTACCAGAGTC
TGAAAACGCGGGCGATGGGCGTGCTGCCCGCTGATCTGAACCTGCGTGACCAGGTGGGCGCCACGTTTGA
TCAGGTCTTTACCTCCGGGGATGATAATAAGCTCATTGTTCCGCAGTTCCTCACCCGTTACGGTCTGCAA
AGTTATTTTGTCAAACAGCGCGACGCGCTGATCGAACTGACGGCGATGGATTCCTGGGTGCTGAACCTGA
CCCGCAGCGTGAAATACAGCGACGCCGACCGGGCGGAAATCCAGCGCCAGCTCACTGAACAGTATCTCAG
CGACTACACCGCCACCTGGAGCGCCGGAATGGACAACCTTAACGTGCGCAATTACGAATCCATTGCGCAA
CTGACCGGGGCGCTGGAGCAGATCATCAGCGGCGATCAGCCGCTCCAGCGGGCGCTGACGGCACTGCGCG
ACAACACGCAGCCTGCCGTTCTCTCTGAAAAACTGGATGACAAGGCGCTTCAGGAGGCGATGGCGGAGCC
GGATTACCAGTTGCTGACCCGCCTGGGGCACGAATTTGCCCCGGAAAACAGCACGCTGGCGGTACAGAAA
GACAAAGAAAACACTCTCCAGGCGGTCTATCAGCAACTGACGGAGCTGCACCGTTACCTGCTGGCTATTC
AGAACGCGCCGGTGCCGGGAAAATCAGCGCTGAAAGCGGTGCAGCTACGGCTGGATCAGAACAGCAGCGA
TCCTATTTTCGCCACCCGCCAGATGGCGAAAACCCTGCCTGCCCCGCTCAACCGCTGGGTGGGCAAGCTG
GCGGATCAGGCCTGGCATGTGGTGATGGTGGAGGCAGTTCACTATATGGAAGTGGACTGGCGCGACAACG
TGGTCAAACCCTTTAATGAACAACTTGCCGACAATTATCCGTTTAACCCACGCTCACAGTCAGATGCGTC
GCTGGATGCGTTTGAACGCTTCTTTAAACCGAATGGCGTACTGGATACCTTTTATCAGCAGAACCTGCGT
CTGTTTATGGAAAACGATCTGAGTCTGGAGGACGGGGATAACAACGTGATTATTCGTGAGGATGTCCGGG
AGCAACTGGATACCGCACAGGAAATCCGCGAGGCGTTTTTCAGCAGACAGAACGGCCTGGGCGCGCAGTT
TGCCGTGGAAACTGTGTCGCTTTCCGGCAACAAACGGCGCAGCGTGCTGAATCTGGACGGGCAGTTAGTG
GACTACAGCCAGGGCCGCAATTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCAATGAAA
GTAAGCTGACGCTGATAGGCGTCAGTGGCGGCGCGCCGCGCAGCATCAGTTTCAGCGGGCCGTGGGCGCA
GTTCAGGCTGTTCGGCGCCGGGCAACTTACCGGCGTTCAGGAGGGGACATTCAGCGTGCGCTTTAACGTG
GACGGCGGAGCGATGGTGTACCGGGTACATACCGATACGGAAGATAACCCCTTCACCGGCGGGCTGTTCA
GTCAGTTCCGGCTGCCGGATACCCTGTACTGA
 Primer design