SecReT6
Protein ID: 537437156
SecReT6 ID842
T6SS typei1
Gene symbol-
Locus tagSPUCDC_1903
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
Repliconchromosome [GenBank: NC_022221] [Browse all T6SS(s) in this replicon]
Location [Strand]1900815..1902209 [+]
Producthypothetical protein
NoteTssA
UniProt IDT1YIH8
KEGG IDsega:SPUCDC_1903
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.10E-45, Aligned region: 93..156
DUF3702 [PF12486], Evalue: 2.10E-45, Aligned region: 262..271
DUF3702 [PF12486], Evalue: 2.10E-45, Aligned region: 292..438
ImpA-rel_N [PF06812], Evalue: 2.40E-21, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 2.40E-21, Aligned region: 238..265
Protein Sequence: 464 a.a.     [Download]
>gi|537437156|ref|YP_008481533.1| hypothetical protein SPUCDC_1903 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67]
MSQDALTHIIVTGQDPRGLPEFSALREEINKSSHPSQPELNWKLVESLALAIFKAHGVDLHTATYYTLAR
TRTHGLAGFCEGVELLAAMISHDWDKFWPQDESARTGMLDWLNSRTGNILRQQLSFSGADLPLLYRTERA
LQLICDKLQQVELKRQPHVENLLYFVQNTRKRLEPPPKSSVDIPPQTTIRTLIYAPESTQPLTAENLPPL
PELPEMKVEVHHGAVEDPEPVARATSGRTIKGFMAGVVCAAAVAAALWWWQVYPMQQQLAQVRDTAQGAA
MLWLASPELDSYGQRLQQLPDASPLQLLEAGMQMMHTADSRWPESLQQQQATAQWNEILKTRAQSSPQMR
GWQQARQNLRDFADLMMQRETEKQGFTLSYIKTVTWQAERLLNQETPLESLLTQYQDARAQGRNAEVLEK
QINERLDGVLSRWLLLKNNVVPETATKAPPPKIIVKSRRLTWPI
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|537435369|ref|NC_022221.1|:1900815-1902209 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67, complete genome
ATGAGTCAGGACGCACTCACGCACATTATTGTTACCGGCCAGGATCCGCGCGGCCTGCCGGAGTTCAGCG
CCCTGCGGGAAGAGATCAACAAATCGTCTCACCCGTCGCAGCCGGAGCTGAACTGGAAACTGGTGGAATC
GCTGGCGCTGGCCATTTTTAAAGCCCATGGCGTGGATCTGCACACGGCCACTTATTACACCCTGGCGCGC
ACCCGCACGCACGGCCTGGCCGGATTTTGCGAAGGAGTGGAGCTACTGGCGGCCATGATAAGCCACGACT
GGGACAAATTCTGGCCGCAGGATGAGTCAGCCCGCACCGGGATGCTTGACTGGCTTAATTCGCGCACCGG
CAATATTCTGCGCCAGCAGCTGTCCTTCTCCGGCGCGGACCTGCCGTTGCTGTACCGCACCGAACGGGCG
TTACAGTTGATTTGCGACAAACTCCAGCAGGTGGAACTGAAACGCCAGCCGCATGTGGAGAACCTGCTTT
ATTTTGTGCAGAACACACGTAAGCGGCTTGAGCCGCCGCCGAAAAGCAGCGTGGACATTCCGCCGCAGAC
CACCATCAGAACGTTGATCTACGCCCCGGAGAGCACGCAGCCCCTCACGGCGGAAAACCTTCCGCCCCTG
CCTGAGTTGCCGGAAATGAAGGTGGAAGTCCACCACGGCGCGGTGGAGGATCCAGAGCCTGTCGCCAGGG
CCACGTCAGGCCGGACTATAAAAGGCTTTATGGCCGGTGTCGTCTGCGCTGCGGCTGTCGCAGCCGCACT
CTGGTGGTGGCAGGTGTACCCGATGCAACAGCAACTGGCGCAGGTAAGGGACACGGCGCAGGGCGCGGCA
ATGCTCTGGCTGGCCTCGCCTGAACTGGACAGCTACGGGCAGCGGTTACAACAGCTTCCCGACGCCTCGC
CGCTGCAACTGCTGGAGGCGGGGATGCAGATGATGCATACCGCAGACAGCCGCTGGCCGGAGAGTCTGCA
ACAGCAGCAGGCAACAGCGCAGTGGAATGAAATCCTGAAAACCCGCGCGCAAAGCAGCCCACAAATGCGC
GGCTGGCAGCAGGCGCGCCAGAATCTGCGTGACTTTGCTGACCTGATGATGCAGCGGGAAACGGAGAAGC
AGGGCTTTACCCTCTCCTATATTAAAACGGTGACCTGGCAGGCGGAACGCCTGCTGAACCAGGAAACGCC
GCTGGAGTCCCTGCTGACGCAGTACCAAGATGCCCGCGCTCAGGGACGGAATGCGGAGGTGCTGGAAAAA
CAAATTAATGAACGGCTGGATGGGGTGTTAAGCCGCTGGCTGTTGCTGAAAAACAATGTAGTGCCGGAAA
CGGCAACTAAAGCCCCCCCCCCGAAAATAATAGTTAAATCAAGGAGATTAACATGGCCAATTTAA
 Primer design