SecReT6
Protein ID: 537454112
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07320
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1524561..1524857 [-]
Producttype VI secretion protein
NotePAAR
UniProt IDT1XXD5
KEGG IDlag:N175_07320
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 6.00E-20, Aligned region: 2..19
PAAR_motif [PF05488], Evalue: 6.00E-20, Aligned region: 23..90
DUF4150 [PF13665], Evalue: 0.00041, Aligned region: 7..47
DUF4150 [PF13665], Evalue: 0.00041, Aligned region: 38..89
Protein Sequence: 98 a.a.     [Download]
>gi|537454112|ref|YP_008487884.1| type VI secretion protein [Listonella anguillarum M3]
MLPAARATDMHMCPMQTPAVVPIPHVGGPLLPLPTTVLIGNLPAATLGQICVCVGPPDSIVKGSATVLIN
NKPSARMGDLTAHGGTIVMGMPTVLIGG
 
Nucleotide Sequence: 297 bp     [Download]
>gi|537452888|ref|NC_022223.1|:c1524857-1524561 Listonella anguillarum M3 chromosome 1, complete sequence
ATGCTTCCAGCAGCCAGAGCAACAGACATGCACATGTGCCCGATGCAAACACCAGCAGTGGTGCCAATCC
CTCACGTAGGCGGGCCATTACTCCCTCTGCCAACAACAGTATTAATCGGCAACCTACCAGCTGCCACTCT
AGGACAGATATGTGTTTGTGTCGGCCCTCCAGATAGCATAGTTAAAGGAAGTGCAACCGTGCTGATTAAC
AATAAACCCTCAGCGCGCATGGGCGACCTAACTGCCCACGGTGGGACTATCGTGATGGGGATGCCAACTG
TCTTGATTGGAGGGTAA
 Primer design