SecReT6
Protein ID: 537454114
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07330
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1525430..1527427 [-]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDT1XZ04
KEGG IDlag:N175_07330
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-46, Aligned region: 34..330
Phage_base_V [PF04717], Evalue: 7.60E-22, Aligned region: 367..457
DUF2345 [PF10106], Evalue: 0.00067, Aligned region: 207..235
DUF2345 [PF10106], Evalue: 0.00067, Aligned region: 520..644
Protein Sequence: 665 a.a.     [Download]
>gi|537454114|ref|YP_008487886.1| type IV secretion protein Rhs [Listonella anguillarum M3]
MNMSSNELKHQTRSLTIKLSDSKSYIVTQLIGEESVSGGCQFSVSIAANMEIDTKNLGKAVCVSYELDSG
KRFFSGICSTLQFTGYSKDKQQFYYQIEILDPLSLLQYKRSRQIFQNVTTKKIIEKLLEQADLKSYFHFS
LSGSGKNHEYCVQLDETDQAFIQRLLANEGWHYHVRHQCNKSTVCIGDSNQRFEKIPDPKLSYQIGGNNQ
QHVLTTWSQAHHVGSGKVSVADHTQNLAEFFDSGPRKSTESYAPTSLTQELFAFGHENKNEVRDAAKMHM
EALDLRKSASHSSSNLATLACGYKFELTYHPLSSMNQEYIITHLSHRLSREESNNEVAYQNQFSCIPSSL
IFRPEIFDKPRVHSLHTATVTGPKGEEIYRDKWGRVKVQFHWDRGGKNDENSSCWLPVSQGFASKGFGSQ
FTPRIGDEVIVQYIDGDPNRPIVTGSLYNKNSAAPYSSDTQNGIKTRSTPKGSSKQGNELRFEDQKDKEQ
VYLHAEKDLLLDVNNDSQSTIKGIKKTQVEKSATLSVKEHIQVESDKTLTAKSKDNWTGDSEKDLSLNAA
SNINIAAKSTVSVDGNQVSICGKSKIELKVGTSKIEISASGIKIDAPQVSVSGKAKAEVKAAMINIEGQG
KVDVKAALVSVNGSSMTQIKAGAMVQIQGAITKVN
 
Nucleotide Sequence: 1998 bp     [Download]
>gi|537452888|ref|NC_022223.1|:c1527427-1525430 Listonella anguillarum M3 chromosome 1, complete sequence
TTGAATATGAGCAGTAACGAATTAAAGCACCAAACCCGCTCCCTCACCATTAAGCTTTCAGATAGCAAAA
GTTATATTGTCACGCAATTAATCGGAGAGGAAAGCGTATCCGGCGGGTGTCAGTTTTCCGTTTCCATCGC
GGCAAACATGGAGATCGATACCAAAAACCTAGGTAAAGCTGTTTGTGTGTCTTACGAATTAGATTCTGGA
AAACGTTTTTTTTCAGGTATATGTAGCACTCTGCAATTCACAGGATATAGCAAAGACAAGCAGCAGTTTT
ATTATCAAATAGAGATATTGGATCCACTTAGCTTGTTGCAATACAAACGCAGTCGTCAGATTTTTCAAAA
CGTAACGACGAAAAAGATCATTGAAAAGCTGCTAGAACAGGCTGATCTCAAAAGCTATTTTCACTTTTCC
CTTTCCGGAAGTGGGAAAAATCATGAGTATTGTGTTCAACTTGATGAAACCGACCAAGCTTTTATACAAC
GCTTGTTAGCAAACGAAGGATGGCACTACCATGTACGCCATCAATGCAATAAGTCGACAGTCTGCATTGG
CGATTCAAATCAACGATTTGAGAAAATACCGGATCCAAAGTTAAGTTATCAAATAGGTGGCAACAATCAG
CAGCACGTACTAACCACGTGGAGTCAAGCCCACCATGTTGGCAGTGGAAAGGTATCTGTCGCCGATCATA
CTCAAAACCTGGCTGAATTTTTTGATAGCGGCCCCCGAAAAAGCACCGAAAGTTACGCGCCGACTTCATT
GACACAAGAACTCTTTGCATTTGGTCACGAGAATAAAAATGAAGTCCGTGACGCAGCAAAAATGCATATG
GAAGCGTTAGATCTTAGGAAGTCAGCCTCTCACTCATCATCAAATTTAGCGACGCTTGCTTGCGGCTATA
AATTTGAACTAACGTACCATCCTCTCAGTTCAATGAACCAAGAGTACATCATCACTCATCTATCACATCG
CCTATCCAGAGAAGAATCGAACAACGAAGTCGCTTATCAGAACCAGTTTTCTTGTATCCCTTCGTCACTG
ATTTTCCGTCCAGAAATATTTGACAAACCGCGTGTCCATAGCTTACATACCGCAACCGTCACCGGGCCTA
AGGGAGAAGAGATTTACCGAGATAAATGGGGTCGAGTAAAAGTGCAATTTCACTGGGATAGAGGCGGAAA
AAATGACGAAAACAGTTCATGTTGGTTGCCAGTATCGCAAGGGTTCGCCAGTAAGGGGTTCGGTTCTCAA
TTCACACCGCGCATTGGTGATGAAGTGATTGTGCAATACATTGATGGCGACCCCAATCGCCCTATCGTGA
CCGGCTCTTTATACAACAAAAACAGCGCAGCCCCTTACAGCTCGGATACTCAAAATGGCATCAAAACTCG
TTCAACGCCTAAGGGCAGTAGCAAGCAAGGAAACGAACTGCGGTTTGAAGATCAAAAAGACAAAGAACAA
GTGTATTTACATGCTGAAAAAGATTTGCTACTTGACGTAAATAACGACAGCCAGTCAACGATTAAAGGCA
TTAAAAAGACCCAAGTTGAGAAGAGTGCCACCTTAAGCGTTAAAGAACACATACAAGTCGAAAGTGATAA
AACACTTACCGCCAAAAGTAAAGATAACTGGACGGGTGACAGTGAGAAAGATCTAAGCCTCAATGCCGCT
TCCAACATCAATATTGCGGCTAAATCGACGGTCAGCGTTGATGGCAACCAAGTGTCGATCTGCGGTAAAT
CGAAGATCGAACTCAAAGTGGGCACGAGCAAAATCGAGATCAGCGCTAGTGGTATTAAGATCGACGCTCC
TCAAGTCTCTGTTTCAGGTAAAGCAAAAGCAGAGGTGAAAGCCGCAATGATCAATATTGAAGGCCAAGGG
AAGGTCGATGTAAAAGCAGCGTTAGTGTCGGTTAACGGCAGCTCCATGACACAAATAAAAGCCGGGGCCA
TGGTGCAAATTCAAGGCGCAATTACAAAGGTAAATTGA
 Primer design