SecReT6
Protein ID: 537454115
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07335
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1528055..1529488 [+]
Producttype VI secretion protein
NoteTssA
UniProt IDT1XZL9
KEGG IDlag:N175_07335
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-08, Aligned region: 83..143
Protein Sequence: 477 a.a.     [Download]
>gi|537454115|ref|YP_008487887.1| type VI secretion protein [Listonella anguillarum M3]
MTLKQIVNLTEQEPMPLSKHQIEQLSKPLSDDSICGVYLKLEKSAFRPLRNEFNVAQTALRKLSQNPSAD
ERDALQEACLNKWKILSDSLYEQFSKTTRDIELISWFVAAQFLLDTTLESAANSLEWLADLSEKHWDHLN
PVLPVETLKSDDDKGKEREQADAKVKAFFQLVGDSEESSILYAPVLQLPLVGEVTFFDFQSAERKGEISQ
LKSMLTTTVAQERFAIQFKMENAKRCVTQLDRLSALVSTKCHSLGSQSTNFGFAKSLLTRVENALVHLSG
IKLAPKAEAKTVEQEVAESSVSEGELPSHMDTKHIERIPMASEQAQTVSQHLHAGNLSELGNLNNMNRDL
AFHLLREVSDYFRQSEPHSPISFLLEKAIRWGYLSLPELLREMMSEQNGDALSTIFNAAGLNHLDQVLLP
EVSTPTVGIESPQTPQAKPSVSDPRSVEEHVSQTSPVDTQSKQDQKPQSSATSALSW
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1528055-1529488 Listonella anguillarum M3 chromosome 1, complete sequence
TTGACACTTAAGCAAATAGTCAACCTAACAGAGCAGGAACCTATGCCTTTGTCAAAGCATCAAATTGAGC
AACTTTCTAAACCTCTGAGTGATGATTCGATCTGTGGCGTTTATCTTAAACTGGAAAAAAGTGCTTTTCG
CCCATTACGTAATGAATTTAATGTCGCGCAAACTGCGCTGCGTAAGCTAAGTCAAAACCCTAGTGCTGAC
GAGAGAGATGCGTTACAAGAGGCATGTCTAAATAAGTGGAAGATTCTCTCTGACAGTTTGTACGAACAGT
TTTCAAAAACAACCAGAGATATCGAGCTCATCTCATGGTTTGTTGCTGCTCAATTCCTTCTCGATACCAC
ATTAGAAAGTGCTGCGAATAGCCTTGAGTGGTTAGCGGATTTAAGTGAGAAGCACTGGGATCACCTCAAC
CCTGTACTACCAGTTGAAACGCTCAAATCTGATGATGATAAGGGCAAAGAAAGAGAGCAAGCAGATGCGA
AAGTTAAAGCATTTTTCCAACTAGTCGGCGATAGCGAGGAAAGCTCGATTCTCTATGCGCCGGTGCTGCA
ACTGCCCTTAGTCGGGGAAGTGACGTTTTTTGACTTTCAAAGTGCAGAGAGAAAAGGCGAAATCAGCCAA
CTGAAATCTATGCTTACGACCACGGTGGCGCAAGAGCGTTTCGCGATTCAATTCAAGATGGAAAACGCCA
AACGTTGTGTCACCCAATTAGATCGTTTGTCAGCGTTGGTGAGCACTAAGTGTCATTCTCTAGGCAGTCA
AAGTACCAACTTCGGATTTGCGAAGTCACTGCTTACCCGTGTTGAAAACGCTTTGGTTCATCTAAGTGGA
ATTAAGTTAGCACCGAAAGCGGAGGCCAAGACAGTAGAGCAAGAGGTTGCCGAAAGTTCAGTTTCTGAAG
GGGAGCTGCCAAGCCATATGGATACAAAACATATAGAGCGAATACCGATGGCATCAGAGCAGGCTCAGAC
CGTAAGCCAACACTTACACGCAGGAAACCTCTCTGAACTGGGTAATTTAAACAATATGAACCGAGACTTA
GCTTTCCATTTGTTGAGAGAAGTCTCTGATTATTTTCGCCAGAGCGAACCGCATAGCCCAATTTCATTTT
TGTTAGAAAAAGCGATTCGATGGGGATATTTATCCTTACCTGAGTTGCTGCGAGAAATGATGTCGGAACA
AAACGGTGACGCTCTTAGTACGATTTTTAATGCCGCCGGATTGAATCATCTCGATCAGGTTTTGCTGCCG
GAGGTGAGTACTCCAACGGTGGGCATTGAAAGCCCCCAAACACCTCAAGCGAAGCCTTCCGTTTCGGATC
CGCGAAGTGTTGAAGAGCATGTATCTCAGACTTCCCCTGTAGATACCCAATCTAAGCAAGATCAAAAACC
ACAATCATCCGCTACGTCGGCTCTGAGTTGGTAA
 Primer design