SecReT6
Protein ID: 537454116
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07340
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1529515..1530045 [+]
Producthypothetical protein
NoteTssD
UniProt IDT1XYF4
KEGG IDlag:N175_07340
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.70E-30, Aligned region: 5..149
Protein Sequence: 176 a.a.     [Download]
>gi|537454116|ref|YP_008487888.1| hypothetical protein N175_07340 [Listonella anguillarum M3]
MASIYMRVSGLQVEGAATIGQLETAEGKNDGWFAINSYSWGGARNVAMDIGNGTNADSGMVGVSEVSVTK
EVDGASEDLLSYLFNPGKDGKTVEVAFTKPSNDGQGADVYFQVKLEKARLVSYNVSGTDGSQPYESLSLS
YTSISQKHHYEKEGGELQSGGVVTYDLPTGKMTSGK
 
Nucleotide Sequence: 531 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1529515-1530045 Listonella anguillarum M3 chromosome 1, complete sequence
ATGGCAAGTATTTACATGCGTGTAAGCGGTCTTCAAGTTGAGGGCGCAGCGACTATCGGTCAGCTAGAAA
CGGCTGAAGGTAAAAATGACGGTTGGTTTGCAATCAACTCTTACTCTTGGGGTGGCGCTCGTAACGTTGC
TATGGACATCGGTAACGGCACCAATGCGGATTCAGGCATGGTTGGCGTAAGCGAAGTTAGCGTAACTAAA
GAAGTCGATGGTGCTTCTGAAGACCTACTGTCTTATTTATTCAACCCAGGTAAAGACGGTAAAACTGTTG
AGGTTGCATTTACTAAGCCTTCTAACGATGGTCAAGGTGCAGACGTTTACTTCCAAGTTAAGCTAGAAAA
AGCACGTTTAGTTTCTTACAACGTGAGCGGGACTGACGGATCTCAACCGTACGAGAGCCTATCTCTTTCT
TACACTTCTATTTCTCAGAAGCATCACTATGAGAAAGAAGGTGGTGAACTACAAAGCGGTGGTGTTGTGA
CTTACGACCTACCGACCGGGAAAATGACTTCTGGTAAGTAA
 Primer design