SecReT6
Protein ID: 537454117
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07345
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1530115..1530624 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDT1XXE0
KEGG IDlag:N175_07345
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.60E-56, Aligned region: 7..162
Protein Sequence: 169 a.a.     [Download]
>gi|537454117|ref|YP_008487889.1| type VI secretion protein [Listonella anguillarum M3]
MALNSQHKRVSKNRVSITYDVETNGAVETKELPFVVGVIGDFSGHKPESEKVDLEEREFTGIDKDNFDTV
MGQIHPRLSYKVDNKLANDDSQFEVNLSFRSMKDFHPENLVDQIEPLKQLVETRNQLKVLLSKADRSRDL
ERLLKEVLQSADAINGLAQELGLSREGAE
 
Nucleotide Sequence: 510 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1530115-1530624 Listonella anguillarum M3 chromosome 1, complete sequence
ATGGCATTGAACTCACAACATAAGCGCGTTAGTAAGAACCGTGTCAGCATCACCTATGACGTTGAAACGA
ATGGCGCCGTAGAGACGAAAGAGCTGCCGTTTGTTGTTGGCGTCATTGGCGACTTTTCAGGACACAAACC
AGAATCAGAAAAAGTTGATTTAGAAGAGCGAGAGTTCACGGGTATCGATAAAGACAACTTCGATACAGTG
ATGGGGCAAATTCACCCGCGTCTTTCGTACAAGGTTGATAACAAGCTTGCTAATGATGATAGCCAGTTTG
AAGTGAACTTGAGCTTCCGTTCGATGAAAGATTTCCACCCAGAGAACTTAGTTGATCAAATTGAGCCGCT
TAAGCAGTTGGTTGAAACACGTAACCAGCTAAAAGTACTCTTAAGCAAAGCCGATCGTTCGAGAGATCTT
GAGCGTCTACTGAAAGAAGTTCTGCAAAGCGCAGATGCCATCAATGGTTTAGCTCAAGAACTAGGTTTGA
GCAGAGAGGGAGCGGAATAA
 Primer design