SecReT6
Protein ID: 537454118
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07350
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1530624..1532105 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDT1XXZ3
KEGG IDlag:N175_07350
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-163, Aligned region: 63..492
Protein Sequence: 493 a.a.     [Download]
>gi|537454118|ref|YP_008487890.1| EvpB family type VI secretion protein [Listonella anguillarum M3]
MSVEQQAVQGTTTEAEAKQSFLDRAINATAQTPVDTTKELLSVMASQALEGTVTWDKNLTLTIEKAISAL
DSKISEQLSTVMQNDEFQKMEGSWLGLQKLVKNSELGSDLKIKVADYTKDELLEQFEDAPAIDRSRFFNM
VYQEEFGTAGGQPYGALLGDYGFGYGDEDVALLRYMAEVASASHAPFVAAANASMFDFKAFSSFSEGKPV
AAGFDSPAYASWNAFRESDDSRYVALTLPKTMARLPYGAATVPVKSFAFEELQIRDNGQQIVSSDCDFVW
SNAAYEFGLLMTQAYTKYGWCTAIRGTENGGKVENLPNFTHYSEAGELLQQCPTEVNLTDEREKELSDLG
FLPLVHYKSTNYAVFMGAQTAHKPKTYTDPDATANAAISARLPYTMASSRIAQYLKIMGRDRIGSNLAPN
DVEKELNSWINQYVNPNAIGNDAKATHPLVEAKVTVEEQAGRPGAYSAVAYLRPWLQMEELTTSLRMVAN
IPG
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1530624-1532105 Listonella anguillarum M3 chromosome 1, complete sequence
ATGTCTGTAGAACAACAAGCAGTACAAGGTACTACTACTGAAGCAGAAGCAAAGCAGAGCTTTCTTGACC
GAGCGATCAACGCGACAGCACAAACACCAGTAGATACGACAAAAGAGCTATTGAGCGTCATGGCTTCTCA
AGCACTGGAAGGTACAGTGACTTGGGATAAGAACCTAACGTTGACGATTGAAAAAGCAATCAGCGCGCTA
GACAGCAAAATCTCTGAGCAGTTGTCAACGGTGATGCAAAACGATGAGTTCCAAAAAATGGAAGGTTCAT
GGCTAGGTTTGCAAAAGCTTGTAAAAAACAGCGAGCTAGGATCAGATCTGAAAATCAAAGTGGCGGATTA
CACCAAAGACGAATTGCTAGAGCAGTTTGAAGATGCACCAGCGATCGATCGCAGCCGTTTCTTCAATATG
GTTTATCAAGAAGAATTTGGAACAGCGGGCGGTCAGCCATACGGTGCATTGCTAGGTGACTACGGATTCG
GTTACGGTGATGAAGACGTTGCCCTGTTGCGTTACATGGCTGAAGTCGCTTCTGCATCTCACGCACCTTT
CGTCGCTGCAGCGAATGCAAGTATGTTCGACTTCAAGGCATTCAGTAGCTTTTCTGAAGGCAAACCAGTT
GCAGCAGGCTTTGATTCGCCAGCATATGCAAGCTGGAATGCATTCCGTGAAAGCGATGACTCGCGCTACG
TTGCTCTGACTCTACCGAAAACGATGGCTCGCCTTCCTTACGGTGCAGCAACCGTTCCAGTTAAATCATT
TGCATTTGAAGAACTTCAAATTCGGGACAACGGTCAGCAAATTGTGTCTTCAGACTGCGATTTTGTTTGG
AGCAATGCGGCGTATGAGTTTGGTCTTCTGATGACTCAAGCATATACCAAGTACGGTTGGTGCACGGCGA
TCCGAGGTACTGAGAACGGCGGTAAAGTAGAGAACCTGCCAAACTTCACTCACTACTCTGAGGCCGGTGA
ATTGCTACAGCAATGCCCGACAGAAGTTAACCTAACGGATGAGCGTGAGAAAGAGCTGAGTGATCTTGGC
TTCTTGCCACTGGTTCACTACAAAAGCACCAACTACGCAGTGTTTATGGGTGCTCAGACTGCGCATAAAC
CAAAAACGTACACAGATCCAGATGCAACGGCAAACGCGGCAATTTCAGCGCGTCTGCCATACACAATGGC
AAGCAGCCGAATCGCACAGTACCTAAAAATCATGGGCCGTGATCGTATTGGTTCAAACCTAGCTCCAAAT
GACGTTGAGAAAGAGCTGAACTCTTGGATTAATCAATACGTTAACCCAAATGCGATTGGTAACGATGCGA
AAGCAACACATCCATTGGTTGAAGCGAAAGTGACGGTAGAAGAGCAAGCTGGACGCCCAGGTGCTTACTC
TGCAGTGGCTTACTTACGCCCTTGGCTGCAAATGGAAGAGCTAACCACTTCACTACGAATGGTTGCGAAC
ATTCCTGGCTAA
 Primer design