SecReT6
Protein ID: 537454119
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07355
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1532152..1533507 [+]
Producttype VI secretion protein
NoteTssC
UniProt IDT1XZ10
KEGG IDlag:N175_07355
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.00E-125, Aligned region: 38..442
Protein Sequence: 451 a.a.     [Download]
>gi|537454119|ref|YP_008487891.1| type VI secretion protein [Listonella anguillarum M3]
MYTNSEFDRILAENPAWQEILVCAKSRSVVQFKASLVRLISEIDTSISEQLSDVIQHPNFKQLEASWTGL
KSLAQLQVSQRRVKIKMLDLSWSMVSADLNYSFDLKQSSLYRKLYSNELDTAGGSPFGMVMVDHKVSADY
ADDQEYDDLYTLQLLSELGELCFCPMVLGTDEFFFGDEPRRQLHDSARIERILTSRDFVSWQLLREKNSS
RFLHLVMPEHLIRQPYCQYQAGFVFNERQQEKYALWGSSAYLLLGNVMREFDRISWFGFLRSYDETGSYG
AIVQDSKELKTKVEIYSEDDGFWSSQGFMPLTSIYISGHKGFFSNQSVWQAPDEAQRQLGMLQTNLMACR
FAHYIKVQIRDQVGRYDSAETCRRSLERWLEQFISNVNYGEDAVLARYPLRSCYVRIEEVPHDKTRYLCE
IMLQPQYQYEMMDAKVVLTTSVSGSEVGETS
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1532152-1533507 Listonella anguillarum M3 chromosome 1, complete sequence
ATGTATACAAATTCCGAATTCGATCGCATTTTAGCTGAGAATCCTGCCTGGCAGGAGATATTAGTGTGCG
CGAAAAGTCGGTCGGTGGTTCAATTCAAAGCATCGTTGGTTCGTTTGATCTCCGAGATTGATACGTCAAT
AAGTGAACAGTTGTCAGACGTTATTCAACACCCTAACTTTAAGCAGTTAGAAGCCTCTTGGACGGGGCTC
AAATCGTTAGCGCAGCTGCAAGTATCCCAGCGTCGAGTAAAAATCAAAATGCTCGACTTGAGTTGGAGTA
TGGTTTCGGCAGATCTCAATTACTCTTTCGATCTAAAGCAGTCATCCCTATACCGAAAACTGTATTCAAA
TGAGCTGGATACCGCCGGTGGCAGCCCATTTGGCATGGTGATGGTCGATCACAAGGTCTCGGCTGATTAC
GCCGATGATCAGGAGTATGACGATCTCTACACCCTTCAACTGCTCTCTGAGCTGGGGGAGCTCTGTTTTT
GCCCAATGGTGCTCGGAACTGACGAGTTTTTCTTTGGTGATGAACCAAGAAGGCAGCTTCATGACAGCGC
GAGAATTGAGCGCATTCTTACTAGTCGAGATTTTGTTTCTTGGCAGTTGCTACGAGAAAAAAACTCATCA
CGATTTTTGCACTTGGTCATGCCTGAACATTTGATTCGTCAACCATACTGTCAATATCAGGCTGGATTTG
TTTTTAACGAGCGCCAGCAAGAGAAATATGCCTTGTGGGGCAGCAGCGCTTACCTCTTGCTAGGTAATGT
GATGCGAGAGTTTGATCGAATCAGTTGGTTTGGATTCCTGCGTTCTTACGATGAGACAGGTTCGTATGGG
GCTATCGTTCAGGACTCAAAAGAACTTAAGACCAAGGTAGAGATCTACAGTGAAGATGATGGCTTTTGGT
CGTCTCAGGGGTTCATGCCTTTAACCAGTATTTACATAAGTGGCCATAAAGGTTTCTTCAGCAATCAATC
CGTTTGGCAAGCGCCTGATGAAGCTCAACGTCAGCTCGGTATGCTCCAAACCAACCTGATGGCTTGCCGA
TTTGCCCATTACATCAAGGTCCAAATTCGTGATCAAGTTGGTCGATATGACAGTGCAGAAACTTGTCGAC
GCAGTCTAGAGCGATGGCTAGAGCAGTTCATAAGCAACGTCAATTATGGTGAGGATGCCGTACTTGCCCG
ATATCCACTGCGGTCTTGCTATGTACGCATTGAAGAGGTTCCTCATGATAAAACCCGCTACCTATGCGAG
ATCATGCTTCAGCCTCAATATCAATACGAAATGATGGATGCGAAAGTGGTGTTAACAACTTCGGTATCTG
GCAGTGAGGTTGGAGAGACATCATGA
 Primer design