SecReT6
Protein ID: 537454120
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07360
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1533504..1533920 [+]
Producttype VI secretion protein
NoteTssE
UniProt IDT1XZM4
KEGG IDlag:N175_07360
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-11, Aligned region: 16..112
Protein Sequence: 138 a.a.     [Download]
>gi|537454120|ref|YP_008487892.1| type VI secretion protein [Listonella anguillarum M3]
MSLMAKLTQSWNDDIDSVRDAIVDNVCDLISSRAPLCSEMLLSEKGTIAELGMRNMARAQSKNNTSDIVA
EIEVLVRNFEPRLSQVEIDVQEGELGSNQLSFRLSAVVHSELGDEAIVLDSFLDLSSNKLDVRKSNFV
 
Nucleotide Sequence: 417 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1533504-1533920 Listonella anguillarum M3 chromosome 1, complete sequence
ATGAGCTTAATGGCTAAGTTAACCCAAAGCTGGAATGACGATATCGATAGTGTTCGAGATGCAATTGTTG
ATAACGTCTGTGATCTTATTTCCAGCCGAGCACCTCTGTGTTCAGAGATGCTTTTATCGGAAAAAGGAAC
GATTGCCGAGCTCGGTATGCGCAACATGGCTCGCGCTCAAAGTAAAAACAACACCAGTGACATTGTCGCA
GAAATTGAAGTGCTGGTCCGAAACTTCGAACCTCGCCTGAGCCAGGTAGAGATTGATGTTCAAGAAGGGG
AACTGGGTAGCAACCAATTGAGCTTTCGCCTTTCCGCCGTGGTGCATTCAGAGCTTGGTGATGAAGCGAT
CGTACTGGATTCTTTTTTGGATTTGAGCAGCAACAAACTAGATGTAAGGAAGTCGAATTTTGTCTGA
 Primer design