SecReT6
Protein ID: 537454121
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07370
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1535676..1536659 [+]
ProductImpH
NoteTssG
UniProt IDT1XYF9
KEGG IDlag:N175_07370
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-54, Aligned region: 33..311
Protein Sequence: 327 a.a.     [Download]
>gi|537454121|ref|YP_008487894.1| ImpH [Listonella anguillarum M3]
MQEFVVSRFAHGAFEGQLEKAWQIFKHQAHLKGQRPEVRFSAEILPAYYQAEVSMVTSEREGEFTVKTSL
AALSGNSGSMPRAMYGDALKARFELGDEAPLDFFDMFNNRYYRLYCETKQKHELTYQIEEEAFHWNRDRQ
SITEMLSSLAGQTGDKAPMPESHLVQYTGLLGLKLTCPLALKSMLEDYFESEFEVERSGLEYLPLTECSL
TQIGQAGNNHQLGVGALVGMSTPMTGQKLSIKICPQDYQHYLKIRSDKEMVLALDHMVRSYMGVNTKYAL
YMKVNSQYLPRVKLSGSHQKALRIGQSAWMSHQSDRQQFVEMPLTKS
 
Nucleotide Sequence: 984 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1535676-1536659 Listonella anguillarum M3 chromosome 1, complete sequence
GTGCAAGAGTTTGTTGTAAGCCGTTTCGCTCATGGTGCGTTTGAAGGTCAGCTAGAAAAAGCGTGGCAGA
TCTTCAAGCATCAGGCTCATTTAAAGGGGCAGCGACCTGAAGTGAGGTTCAGTGCGGAAATTCTCCCAGC
TTACTATCAAGCAGAAGTCTCTATGGTTACTTCTGAGCGAGAGGGTGAATTTACGGTAAAGACATCATTG
GCGGCTTTGTCTGGCAACTCTGGTTCGATGCCAAGAGCGATGTATGGCGATGCACTAAAAGCGCGTTTTG
AACTTGGTGATGAAGCACCACTCGACTTTTTCGACATGTTTAATAACCGTTACTACCGCTTGTACTGCGA
AACAAAGCAAAAGCATGAGCTGACGTATCAGATTGAGGAAGAGGCGTTTCATTGGAATCGTGACCGTCAA
TCTATCACTGAAATGCTTTCCAGTTTGGCGGGACAGACTGGAGATAAGGCACCAATGCCGGAATCTCACT
TGGTGCAATACACTGGCTTATTAGGGTTGAAGTTAACCTGTCCATTGGCGCTTAAGTCGATGCTAGAAGA
TTACTTTGAGTCGGAGTTTGAGGTTGAACGCAGTGGCCTAGAGTATTTGCCTCTCACGGAGTGTTCGTTA
ACTCAAATTGGCCAAGCCGGAAACAATCATCAATTGGGAGTGGGCGCGTTGGTCGGGATGTCGACGCCAA
TGACGGGGCAGAAACTCAGCATAAAAATTTGCCCTCAAGACTATCAGCATTACTTAAAAATACGCAGTGA
CAAAGAGATGGTTCTTGCGCTGGACCATATGGTTAGAAGCTATATGGGAGTGAATACCAAGTATGCACTC
TATATGAAGGTAAATAGCCAGTATCTGCCGAGAGTGAAGCTATCAGGCAGTCACCAAAAAGCGTTACGAA
TTGGCCAATCCGCGTGGATGAGTCATCAATCAGATCGTCAACAGTTTGTTGAAATGCCACTGACGAAAAG
TTAG
 Primer design