SecReT6
Protein ID: 537454127
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07400
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1544614..1545585 [+]
Producthypothetical protein
NoteFha
UniProt IDT1XXF0
KEGG IDlag:N175_07400
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-12, Aligned region: 38..105
Protein Sequence: 323 a.a.     [Download]
>gi|537454127|ref|YP_008487900.1| hypothetical protein N175_07400 [Listonella anguillarum M3]
MNLLKVSQMPLSIRIISSPDGESIAQWNQAFPDDGGDIGRAFGATLQLNDASREISSTHAMIRKTSRGYQ
IMDNSTNGLYINGSDVPLGKGNQSTLSDGDVLDIGRYRLLVSCFFPETAKAQIQQPHSDSCRLGDDPFST
ESTPFIQSIPEVDEAPGFTISTTDVVGDDPFASDASVKQELAPHFNLDFQTAEDDPLKDSDFRTSFPNHE
VMATSSFAQEESPLNHSQFAITEFKNHGQRLQERTDKALEMALARLLSDISPNAMESMFDDLSGNGFWSR
KPKYWDMYKRYFNRQVENRDWQIKFQAYFRDAMRMQKNFEGDQ
 
Nucleotide Sequence: 972 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1544614-1545585 Listonella anguillarum M3 chromosome 1, complete sequence
TTGAATTTATTGAAGGTCAGTCAAATGCCTCTATCGATTAGAATTATTAGCTCTCCAGATGGTGAAAGCA
TCGCCCAATGGAATCAAGCATTTCCAGACGATGGCGGAGATATCGGGCGTGCGTTTGGCGCGACGCTACA
ACTTAATGACGCAAGTCGTGAGATTTCAAGTACCCATGCAATGATTCGTAAGACCTCGCGTGGATACCAA
ATCATGGACAACAGCACCAATGGCCTTTACATCAATGGATCTGATGTGCCTTTGGGCAAGGGTAACCAAT
CTACACTAAGTGATGGTGATGTTCTTGATATTGGCCGCTACCGATTGCTGGTTTCTTGTTTCTTCCCTGA
AACAGCGAAAGCGCAAATCCAGCAGCCTCACTCAGATAGTTGTCGATTAGGTGATGATCCGTTTAGTACT
GAATCAACACCTTTTATTCAAAGTATTCCTGAAGTAGATGAAGCGCCTGGGTTCACCATCTCGACGACAG
ATGTGGTGGGGGATGACCCATTTGCGAGTGATGCCTCAGTTAAGCAAGAACTAGCGCCTCACTTTAATCT
TGATTTTCAGACGGCTGAGGATGACCCACTGAAAGACAGTGATTTTCGTACGTCATTTCCAAACCATGAA
GTGATGGCGACCTCCTCTTTCGCTCAAGAAGAGTCACCACTGAACCACTCTCAGTTTGCTATCACTGAGT
TTAAGAATCATGGGCAGCGCTTACAGGAACGTACGGACAAAGCATTAGAGATGGCATTGGCAAGGTTGTT
GTCTGACATTTCACCGAATGCGATGGAGTCGATGTTTGATGATTTGTCGGGCAACGGTTTTTGGTCTCGT
AAACCGAAGTACTGGGATATGTACAAACGCTATTTCAACCGACAAGTAGAGAATCGCGATTGGCAAATTA
AGTTTCAAGCGTACTTCAGAGATGCAATGCGTATGCAAAAAAACTTCGAAGGGGATCAGTAA
 Primer design