SecReT6
Protein ID: 537454128
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07405
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1545585..1546052 [+]
Producthypothetical protein
NoteTssJ
UniProt IDT1XY06
KEGG IDlag:N175_07405
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.10E-32, Aligned region: 12..144
Protein Sequence: 155 a.a.     [Download]
>gi|537454128|ref|YP_008487901.1| hypothetical protein N175_07405 [Listonella anguillarum M3]
MVRRLCLMCIVLIMSGCSLWSYDMVEPKLVVDIKAATNINPNVEGKPSPVELRIYQLTNNNAFEISDFIQ
VYNDDQGVLKAELAVSRQLPSILPGETRQEIIPLGSGVKYIGVIAGFADYREAKNKVIYKPLIVNSAVIS
IEIDGINLSVSGEEE
 
Nucleotide Sequence: 468 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1545585-1546052 Listonella anguillarum M3 chromosome 1, complete sequence
ATGGTACGTCGTTTATGCCTAATGTGTATCGTCCTTATTATGTCAGGGTGCAGTTTATGGAGCTATGATA
TGGTTGAGCCAAAACTGGTCGTTGATATTAAAGCTGCGACCAATATTAACCCTAATGTTGAGGGTAAGCC
TTCTCCGGTAGAGCTCCGAATTTATCAATTGACGAATAATAATGCGTTTGAAATTTCTGATTTTATTCAA
GTTTATAATGATGACCAAGGCGTTTTAAAGGCCGAGTTGGCCGTTTCTCGCCAGCTACCCAGCATTTTGC
CGGGCGAAACTCGTCAGGAAATTATCCCACTTGGTAGTGGTGTTAAGTACATCGGTGTGATTGCGGGTTT
TGCTGATTACAGAGAGGCGAAAAACAAGGTGATTTATAAGCCGCTAATTGTGAATTCAGCGGTTATCAGT
ATTGAAATTGATGGCATTAATCTGTCTGTGTCAGGGGAAGAAGAATAA
 Primer design