SecReT6
Protein ID: 537454129
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07410
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1546052..1547368 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDT1XZ20
KEGG IDlag:N175_07410
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-114, Aligned region: 18..438
Protein Sequence: 438 a.a.     [Download]
>gi|537454129|ref|YP_008487902.1| type VI secretion protein [Listonella anguillarum M3]
MDNNKVVWSEGMFLSPQHFQQQERYVEHFTREFAGQISPNAYGFTSLELDRSMLNIGKVSVRRAKGIFPD
GTPFEIEQALVLDVPKNTSHKKVYLALPVSRPGTIDVGEDARLRHSSQEHPVYDTSREHSDPVQLELATL
NIQLRLEGDELKDFVLISVAEISEHKSEGVVVLNQAFVPQCLQFSVSNYLTDNVADLFAQVQYRSRAIHT
RLQAESSSKSYQSLMRDYLWLQVLGAWMPKLEQWSLDGSLLTRHLYLECVSMAGQMQGLEGKMPKSFPAW
NQDALYSIFSTVFSELLVLLREVQIDNVSTLNWDKQLFVSRRLLRTLVDDRSLYNQGRFVLAVSSSIGAT
RLSEEFPRAAKLAGNSDIAGLVRNALSGVPLRHLPYAPSELKSLNDAAYFEIDTKSELWQALIKRDEAIA
LHIDERIDDLHVDFHVIR
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1546052-1547368 Listonella anguillarum M3 chromosome 1, complete sequence
ATGGATAATAATAAAGTCGTGTGGAGTGAGGGGATGTTCCTTTCCCCTCAGCACTTTCAACAGCAAGAGC
GCTATGTTGAACATTTTACTCGTGAGTTCGCCGGACAAATTAGCCCTAATGCTTATGGATTCACCTCGCT
AGAGCTTGACCGTTCGATGTTGAACATTGGTAAGGTTTCGGTGCGTCGCGCTAAAGGCATTTTCCCAGAT
GGAACACCATTTGAAATTGAGCAAGCACTCGTGCTCGATGTGCCGAAAAATACCAGTCATAAGAAAGTGT
ATCTGGCTCTTCCGGTTTCAAGACCGGGCACTATTGATGTGGGAGAAGACGCGCGTCTTAGACACTCTTC
ACAAGAACACCCCGTTTACGATACCAGCCGAGAGCACAGTGACCCGGTTCAATTAGAGCTAGCAACGTTG
AACATTCAGCTGCGTTTGGAAGGGGATGAGCTAAAAGATTTTGTGTTGATATCCGTTGCTGAAATCAGTG
AACACAAATCTGAAGGTGTTGTTGTGTTGAACCAAGCATTCGTTCCCCAATGCTTGCAGTTTTCCGTATC
TAACTACCTAACCGATAACGTTGCTGATCTATTTGCACAAGTACAATACCGTTCCCGAGCGATTCATACT
CGTTTACAAGCGGAGTCCAGCAGTAAAAGCTATCAGTCGTTGATGCGTGACTACTTGTGGCTGCAAGTAC
TGGGGGCTTGGATGCCAAAGCTTGAACAATGGAGTCTAGATGGCTCGTTGCTGACACGTCATCTTTATTT
AGAGTGTGTTTCGATGGCTGGGCAGATGCAGGGTTTAGAAGGGAAGATGCCAAAGTCTTTCCCTGCATGG
AACCAAGATGCGCTATACAGCATTTTTTCGACCGTGTTTTCTGAGTTACTGGTGTTACTGCGTGAGGTTC
AGATAGATAACGTATCAACATTGAACTGGGACAAACAGCTGTTCGTTAGCCGCCGCTTACTGCGCACACT
GGTTGATGATCGCAGCCTATACAATCAAGGCCGTTTTGTGTTGGCCGTTTCCTCGTCTATCGGTGCCACT
CGACTCAGTGAAGAGTTTCCTCGTGCTGCGAAGCTAGCAGGGAACAGTGATATTGCCGGTTTAGTGCGTA
ATGCACTTTCAGGTGTTCCTTTGCGCCATCTTCCTTATGCACCTTCTGAGTTGAAGTCTTTGAATGACGC
CGCTTACTTCGAAATCGATACTAAGTCTGAATTGTGGCAAGCGTTGATCAAACGTGATGAGGCGATCGCT
CTTCATATTGATGAAAGAATTGATGATCTCCACGTCGATTTTCATGTGATCAGGTAG
 Primer design