SecReT6
Protein ID: 537454130
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07415
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1547376..1548518 [+]
Productmembrane protein
NoteTssL
UniProt IDT1XZN4
KEGG IDlag:N175_07415
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.00E-52, Aligned region: 50..249
Protein Sequence: 380 a.a.     [Download]
>gi|537454130|ref|YP_008487903.1| membrane protein [Listonella anguillarum M3]
MGGLFNEEPTVQIRRVTSTESAHKQHLLPPKADTSGTERLIEDLAIYGSPLLNAATELLGILVTIKRQGT
PRDINRFRQKLLYAIDAFRLRGLHLDYHPSVIEKSCFVLCAAFDEAVLYTAWGERARWENHSLLSKVFSQ
RDGGEAFFVLLDKASQQPNKLVDFIELQYVLLALGFKGRFRHEDESQLHDITARAYGLIRHYRSESPFPV
PQTPTLIEGKRPWLMISMGKTLGLACLVLASGYGFTEYWYNSRVQPLLAQFSAIDMSDVNLKKNSSDLVY
LSSDADLGRQSESLEEETGMKGKVVTQQWEIILAVFSRASDALRLSTELKQAGYESFTREMEHGVELYLH
AGDDLNTIRKLKNELNVRFGLNATIKRALK
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1547376-1548518 Listonella anguillarum M3 chromosome 1, complete sequence
ATGGGCGGATTATTTAACGAAGAACCGACGGTTCAAATTCGACGAGTGACATCGACCGAATCAGCTCACA
AGCAGCATCTGTTGCCACCCAAAGCGGATACTTCAGGCACAGAGCGATTGATTGAGGATCTTGCCATTTA
TGGTAGCCCTTTATTGAATGCCGCCACGGAACTGTTGGGTATTTTAGTGACGATTAAGCGTCAAGGCACA
CCGAGAGACATCAACCGTTTTCGTCAAAAACTTTTGTACGCCATTGATGCGTTTCGTTTGCGTGGTTTGC
ACTTGGATTACCACCCAAGCGTGATTGAAAAAAGCTGCTTTGTGTTGTGCGCGGCATTTGATGAAGCTGT
GCTGTACACCGCTTGGGGAGAGCGTGCTCGTTGGGAAAATCATTCGTTGTTGAGCAAGGTGTTTTCACAG
CGCGATGGCGGAGAGGCCTTTTTTGTGTTGCTAGATAAGGCCAGCCAGCAGCCGAATAAACTTGTTGATT
TTATTGAGCTTCAGTACGTGCTTTTGGCTTTGGGTTTCAAAGGGCGCTTTCGCCATGAAGACGAGAGCCA
ATTGCATGATATTACCGCTCGTGCGTACGGTCTCATTCGCCACTATCGCAGTGAAAGTCCTTTTCCGGTA
CCGCAAACACCAACGCTAATCGAAGGTAAACGCCCGTGGCTAATGATCAGTATGGGCAAAACGTTAGGCT
TGGCTTGTTTGGTTCTGGCATCCGGGTATGGTTTTACTGAATATTGGTACAACAGCCGCGTGCAGCCGTT
GTTGGCACAGTTTAGCGCGATCGATATGTCAGACGTCAACCTGAAGAAAAACAGCAGTGACTTAGTGTAC
TTAAGTTCCGATGCGGATTTGGGGCGACAGAGTGAAAGCCTAGAGGAAGAAACTGGAATGAAAGGAAAAG
TGGTCACTCAGCAATGGGAGATCATTCTCGCGGTATTTTCTCGGGCGAGCGACGCACTTCGTTTATCGAC
AGAACTCAAACAGGCAGGCTATGAGTCTTTTACTCGTGAGATGGAACATGGCGTTGAGCTTTATCTTCAC
GCAGGTGACGACTTAAACACCATTCGTAAGTTGAAAAATGAACTCAATGTTCGCTTTGGTTTGAACGCCA
CGATTAAAAGAGCGCTGAAATAA
 Primer design