SecReT6
Protein ID: 537454131
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07420
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1548520..1551972 [+]
Producthypothetical protein
NoteTssM
UniProt IDT1XYH2
KEGG IDlag:N175_07420
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.80E-59, Aligned region: 343..389
IcmF-related [PF06761], Evalue: 2.80E-59, Aligned region: 474..769
ImcF-related_N [PF14331], Evalue: 4.80E-49, Aligned region: 166..421
DUF1215 [PF06744], Evalue: 2.80E-32, Aligned region: 887..1009
DUF4381 [PF14316], Evalue: 4.70E-05, Aligned region: 32..131
DUF4381 [PF14316], Evalue: 4.70E-05, Aligned region: 417..475
DUF4131 [PF13567], Evalue: 0.0045, Aligned region: 8..73
Protein Sequence: 1150 a.a.     [Download]
>gi|537454131|ref|YP_008487904.1| hypothetical protein N175_07420 [Listonella anguillarum M3]
MFKKIFSIFLVITAILGTLAFWLTASEEQPVWIKWGMLAVTVVIVFFTCVWWWKQRKLNQTEKEEHDQHV
LLKQDTRVIQQLFRIATKKIQGQARNKLESLYSLPWYLVLGGEKDAKSAILLQNGFEPVNERYLDESDTE
QYLRFWSNDNAVVVEVGHRIFDNDGIDESLWQVLAKQLLKYRPRQGLNGIVTVIGCDRLMTGDKKERTRL
SGIYQEAVLSMGAELSLNLPVYAAFSKADSIADFTGFFESFTACDSENPFGITFECDVSRRYDKQQFEAE
SHALIQSIAGQQFELLRNVSSDKSGSIIAWPYQLRIFLERVNEFLSDIGRENRVREAVWIRGAYLMSSGQ
KGIEHDLLTQVVAERAEFNTNNQVEQQPNRRGFFTQRLFNKVILPEKNIVGVNEWRHAGYLVFRTAVLVS
VVGLISIAGLKLQENWNVDEDWRTTALSQIRFYQNDVQKLSNDNSMSEVVAVLRELGDVVAEGVQPKPWH
EKVSIKQTDTAESVYSAYEKQLHQIMLPKLEELISSELYVYVNLGNPSRIFEILRYYQMLFDREQLNFAE
LQTYLLDNLKDQGELSPDELYSFSLLIEDLFKSQYDKQLQPNLDLIAVATNNLEGLSPERLIYARIKEMP
EYRTQVDLRSQLGEKFDSLFEFTNDFHGYLIPEIFTKQGYSQIDLTVKSPLLRSLMSEFKAIQGDMSGAS
VIELRELSKQVQRLYFSDYIYYWKDLVNNIQIKQFGDASGLSYALRNTRSPATSPLLDVLDAVVVNTTLA
VADQPDTKGQKRAAGQLGLKNAKKVLNKADKVNRAVGDNLLRLQPSFVVNEAFLPFSRFVNGNGKDKDTP
LEQLIVQVDEVNSFFDAALSSSNPGKSFHAYAIAHAQGSSDPIVNFRQAGSKAPNIVASWTKSLSEQVWK
QVVNGSVVYLNTQWDEQVYQFYVSAIEGRFPFDQHGRGEVSLDDFSQFFKPSGRVARYIEETLKPFVYWD
NGMLKLNEVDGLALPINSNTRKQLELVQKLSGIFFGSSGDDLGLRLEVKASSMSTDVTEFRLREAETIYD
YKHGPRVWREITWPTAGVDGYLSAEFYSGQNRVAQQSFTGQWALLRALFANKSSATSSRLIRKLNYKINQ
NNIVLDYTLRDSKQPLDKSLFVQFSLPKQL
 
Nucleotide Sequence: 3453 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1548520-1551972 Listonella anguillarum M3 chromosome 1, complete sequence
ATGTTTAAAAAGATATTTTCTATTTTCTTGGTGATTACTGCCATTTTAGGGACGCTCGCATTTTGGCTTA
CAGCATCAGAAGAGCAACCAGTCTGGATAAAGTGGGGAATGCTCGCTGTCACCGTCGTTATTGTCTTCTT
TACATGTGTTTGGTGGTGGAAACAGCGCAAGCTTAATCAAACAGAGAAAGAAGAGCATGATCAACACGTA
CTGCTTAAACAAGACACGCGTGTGATCCAGCAGCTGTTTCGTATCGCAACGAAAAAGATACAGGGACAAG
CTCGTAACAAGCTAGAAAGCCTTTACAGTCTGCCTTGGTACCTAGTTCTAGGTGGTGAAAAAGACGCGAA
AAGTGCCATTTTGCTACAGAATGGTTTTGAGCCAGTTAACGAGCGCTACTTGGATGAAAGTGATACGGAA
CAGTACCTGCGTTTTTGGAGCAACGATAACGCAGTCGTTGTAGAAGTCGGTCATCGTATATTTGATAACG
ACGGTATTGACGAGTCGCTTTGGCAGGTACTGGCGAAGCAACTACTTAAATACCGTCCGAGGCAAGGGCT
GAACGGCATTGTGACGGTTATTGGGTGTGATCGCCTAATGACAGGAGACAAAAAAGAACGCACTAGGCTC
TCAGGCATCTATCAGGAGGCTGTGTTGTCGATGGGCGCAGAGCTTAGCTTAAACTTGCCTGTTTATGCCG
CTTTCTCTAAAGCTGACTCGATAGCAGACTTCACTGGTTTCTTTGAGAGCTTCACTGCATGTGACTCAGA
AAATCCTTTTGGTATTACCTTTGAATGCGATGTTTCACGTCGTTATGACAAACAGCAGTTTGAGGCAGAA
AGCCACGCGTTGATTCAATCCATTGCGGGGCAGCAGTTTGAGTTACTGAGAAACGTCAGCAGTGACAAGT
CGGGCTCTATTATCGCTTGGCCTTATCAGCTAAGAATTTTCCTAGAGCGCGTCAACGAGTTTTTGAGCGA
CATTGGTCGCGAGAACCGTGTCCGAGAAGCCGTATGGATCCGCGGCGCTTATTTAATGTCATCCGGACAA
AAAGGCATTGAGCACGATTTACTAACACAGGTAGTGGCCGAACGTGCTGAGTTCAACACCAATAATCAAG
TTGAACAGCAGCCAAATCGTCGTGGTTTCTTTACGCAACGTTTGTTCAATAAGGTCATCTTGCCGGAGAA
GAATATCGTCGGTGTTAATGAATGGCGTCATGCGGGTTATCTTGTATTTCGAACCGCTGTTCTAGTCTCC
GTGGTTGGGCTGATTTCTATTGCAGGTCTGAAGTTACAAGAAAACTGGAATGTTGATGAAGATTGGCGCA
CAACGGCTCTATCTCAAATTCGTTTTTATCAAAACGATGTTCAAAAGCTGAGCAATGACAATTCGATGTC
GGAGGTTGTGGCGGTATTAAGAGAACTCGGCGACGTGGTTGCTGAGGGCGTTCAACCTAAACCGTGGCAT
GAGAAAGTCAGTATTAAGCAAACAGATACGGCCGAGAGTGTTTACTCTGCTTATGAAAAACAGTTGCACC
AGATAATGCTGCCAAAGCTAGAAGAGCTGATCAGCAGCGAGCTGTATGTTTATGTGAACCTTGGTAATCC
AAGCCGAATCTTTGAGATTTTGCGTTACTACCAGATGTTGTTTGACCGAGAGCAACTGAACTTTGCGGAA
CTACAAACTTACTTACTTGATAACTTGAAAGACCAAGGTGAGCTTTCTCCGGACGAGCTTTACTCTTTTT
CTCTTTTAATCGAAGACCTGTTTAAAAGTCAGTACGACAAGCAGCTACAACCGAACCTAGACCTGATAGC
TGTTGCAACGAACAACCTTGAAGGCTTGTCACCAGAGCGACTGATTTATGCGCGTATTAAAGAGATGCCA
GAGTACCGTACTCAAGTGGATCTCCGAAGCCAGCTCGGTGAGAAGTTCGATAGTTTGTTTGAGTTTACTA
ATGATTTCCATGGCTATCTGATCCCAGAAATCTTTACTAAGCAGGGCTATAGCCAAATTGATTTGACGGT
AAAGTCGCCTCTGCTTAGAAGCTTGATGAGCGAGTTTAAAGCGATTCAAGGTGATATGTCTGGCGCATCA
GTCATTGAGCTTAGAGAACTGAGCAAACAGGTTCAACGTCTGTATTTTTCCGATTACATCTACTACTGGA
AAGACTTGGTCAACAACATTCAAATCAAGCAGTTTGGCGATGCTTCAGGACTCAGCTATGCACTAAGGAA
CACACGTTCTCCGGCTACGAGTCCACTACTTGATGTATTGGATGCAGTTGTGGTGAACACAACATTGGCT
GTCGCAGACCAACCAGATACGAAAGGACAAAAGCGTGCAGCCGGTCAACTAGGATTGAAGAACGCGAAAA
AGGTGTTGAACAAAGCCGACAAGGTGAACCGAGCAGTTGGCGATAACCTGTTGAGGCTGCAACCTTCATT
CGTCGTAAATGAAGCATTTTTACCTTTCTCTAGGTTTGTGAATGGGAATGGTAAAGACAAGGATACACCA
CTGGAGCAGTTGATCGTTCAAGTTGATGAAGTTAACTCGTTTTTCGATGCCGCATTGTCTAGTTCAAACC
CCGGTAAATCATTCCATGCTTATGCCATCGCCCATGCGCAAGGTAGTAGCGACCCTATCGTGAACTTCCG
TCAAGCTGGTAGCAAGGCTCCAAACATCGTCGCGTCTTGGACGAAGAGTCTCAGTGAACAAGTTTGGAAG
CAAGTGGTGAATGGCAGCGTGGTGTATCTAAATACACAGTGGGATGAGCAAGTTTACCAGTTTTATGTGT
CTGCCATTGAAGGGCGATTCCCATTTGATCAACATGGCCGTGGAGAAGTGAGCTTAGATGACTTTTCTCA
ATTCTTTAAACCAAGTGGCCGTGTGGCTCGCTACATAGAAGAAACCTTGAAGCCGTTTGTTTACTGGGAT
AACGGCATGCTCAAGCTAAACGAAGTTGACGGCCTAGCGCTACCAATAAACTCAAACACTCGTAAGCAAC
TTGAATTAGTTCAAAAACTGAGTGGCATTTTCTTCGGTTCTTCAGGAGATGATCTTGGGTTAAGGCTTGA
AGTAAAAGCGAGCTCAATGAGTACTGACGTGACGGAATTCCGCCTACGAGAGGCTGAAACGATTTACGAC
TACAAACATGGTCCAAGAGTGTGGCGCGAGATAACTTGGCCAACCGCAGGAGTGGATGGCTATTTGAGTG
CAGAATTCTACAGCGGTCAGAATCGAGTCGCACAACAATCATTTACCGGTCAGTGGGCGTTGTTGCGCGC
TCTTTTTGCGAATAAGAGCAGCGCTACATCGAGCCGTTTGATTCGTAAGCTCAACTACAAAATTAACCAA
AACAACATCGTATTGGATTACACGTTGCGTGATTCCAAACAACCATTGGATAAATCTTTATTTGTTCAAT
TCTCGTTGCCTAAGCAGCTTTAA
 Primer design