SecReT6
Protein ID: 537455424
SecReT6 ID843
T6SS typei5
Gene symbol-
Locus tagN175_07365
StrainListonella anguillarum M3
Repliconchromosome I [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]1533913..1535694 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDT1Y2Q8
KEGG IDlag:N175_07365
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.00E-158, Aligned region: 5..593
Protein Sequence: 593 a.a.     [Download]
>gi|537455424|ref|YP_008487893.1| type VI secretion protein [Listonella anguillarum M3]
MSDSLLSYFEQELRFIRNETSQFAERHPGTARALGMRKDSIDDPQIARLIESVALMNGKLQQRLDESYPE
LTESLVNLLFPHYLRPIPSYSMLDFAIFEEANAKHSILKGTEFDVASESGEPVVFRTSENIALLPIQVAS
AEVLFAPFELAKPVGAENAKAMLELTIEATDSGIELRDLDIDQLKLHLKGESHFALRLYDVLAHGRCQVC
IQNNGKSYSLGKSALQPIGFDVNDTILPYQAASFGGFKLLTEFFMFPERFQGFKLGLGNIMQHAIGSEFR
IQIFLNEMSVVQARSIQAQNFSLFCTPLVNLQTKVSEPLQIDFTQKQYPIYLDASQGNDLEVFSVDEVLD
VTEGEPFKVCQIYGDKYNSTETALRWQLVQDTHERGVLRSGLKVADIGHVSATTSSRVWSVTTTATDGIR
AGSLPVNSQVTCRESLTIPAAMNLIRRPTLPVRSRDANKNVWALLCHLHFNYHAILGTDDPTATLKNVFD
LYNHNQAVQNHIYIESLQNIEQEQVVAPIRVSGKTCFAYGTKISVTLDASNVNGGVSLFGHLLDHFFAYF
AGFNSFTQVDIYLEGQDGVYLSFPRRTGCKSLL
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|537452888|ref|NC_022223.1|:1533913-1535694 Listonella anguillarum M3 chromosome 1, complete sequence
TTGTCTGATTCATTGCTTTCCTATTTTGAACAGGAACTGCGCTTTATTCGCAATGAAACCTCTCAGTTCG
CGGAACGTCATCCGGGGACGGCTCGTGCATTGGGAATGCGTAAAGACAGTATTGATGATCCTCAGATCGC
GCGTTTGATTGAAAGTGTTGCCTTGATGAACGGCAAACTTCAGCAGCGTTTGGATGAGTCTTACCCAGAG
CTGACAGAAAGCTTGGTGAACTTGTTGTTCCCGCATTATCTGAGGCCAATACCGTCATACAGCATGTTGG
ACTTCGCTATTTTTGAAGAAGCGAATGCAAAGCACAGTATTCTTAAAGGCACTGAGTTCGATGTCGCGAG
CGAATCTGGCGAGCCAGTGGTGTTTCGTACTTCCGAAAATATAGCGCTGCTTCCAATTCAAGTTGCTTCG
GCTGAAGTGCTGTTTGCGCCATTTGAACTGGCTAAGCCTGTGGGTGCAGAGAACGCAAAAGCGATGCTGG
AGCTGACGATTGAGGCAACCGATAGCGGTATCGAGTTGCGTGATCTAGATATTGACCAGTTGAAACTGCA
TCTCAAAGGTGAAAGTCACTTTGCATTGCGTTTGTATGATGTACTTGCCCATGGTCGCTGTCAGGTGTGT
ATCCAGAATAATGGTAAGAGCTACTCACTAGGTAAGTCTGCGCTACAACCAATCGGCTTCGATGTGAACG
ACACTATTTTACCGTATCAAGCTGCGAGCTTTGGTGGCTTTAAGTTATTGACCGAGTTCTTCATGTTCCC
TGAAAGATTTCAAGGATTCAAATTAGGCCTTGGCAACATCATGCAACACGCAATCGGCTCAGAGTTTCGT
ATTCAGATTTTCTTGAATGAGATGAGTGTGGTGCAAGCTCGTAGCATTCAAGCACAGAATTTTTCTCTGT
TTTGTACGCCATTGGTGAACCTACAAACCAAAGTGTCAGAACCTCTGCAAATCGACTTCACCCAAAAGCA
GTACCCAATTTATCTTGATGCAAGCCAGGGTAATGATTTGGAAGTGTTTTCTGTTGATGAAGTGCTAGAC
GTGACGGAAGGTGAACCGTTTAAGGTCTGTCAGATCTACGGAGACAAGTACAACAGTACAGAGACTGCAC
TTCGTTGGCAGCTCGTACAGGATACCCACGAAAGAGGCGTGCTTCGCAGTGGCTTAAAAGTGGCTGATAT
TGGGCATGTTAGTGCCACGACGTCGTCCAGAGTTTGGTCGGTGACGACAACTGCGACTGACGGCATTCGA
GCAGGTTCATTGCCTGTAAACAGCCAAGTGACATGTCGGGAATCTCTTACGATTCCTGCAGCTATGAACT
TGATCCGCCGCCCAACCTTGCCAGTGCGTAGTCGTGACGCAAATAAGAATGTATGGGCACTGCTTTGCCA
TTTGCACTTTAACTATCACGCGATTCTAGGGACGGATGACCCAACCGCCACGCTGAAAAATGTGTTTGAT
TTGTATAACCACAACCAAGCGGTGCAAAACCACATCTATATCGAGTCCCTGCAAAATATAGAGCAGGAAC
AAGTGGTGGCTCCGATCCGTGTGTCAGGAAAAACATGTTTTGCTTACGGCACAAAAATTTCGGTGACGTT
AGACGCAAGTAATGTCAACGGAGGCGTATCGCTCTTTGGTCATTTGCTTGACCACTTCTTTGCTTATTTT
GCAGGCTTCAACAGCTTTACACAAGTAGATATTTATTTGGAAGGCCAAGACGGTGTTTATCTATCCTTCC
CGAGGAGAACTGGGTGCAAGAGTTTGTTGTAA
 Primer design