SecReT6
Protein ID: 537457114
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17340
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]611038..611442 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDT1Y4Q8
KEGG IDlag:N175_17340
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.80E-43, Aligned region: 1..123
Protein Sequence: 134 a.a.     [Download]
>gi|537457114|ref|YP_008489775.1| type VI secretion protein [Listonella anguillarum M3]
MVGDFKGHTEETPLEERQTVSVDKNNFEAVMRESDLKLTTTVRNKLSGDENAELPVELSFKSLADFEPDS
VAAQVPELNKLVELRQALVALKGPLGNIPAFRERLQELLNSEESREKLLSELSLVSGKEEEPQA
 
Nucleotide Sequence: 405 bp     [Download]
>gi|537456627|ref|NC_022224.1|:611038-611442 Listonella anguillarum M3 chromosome 2, complete sequence
GTGGTGGGTGATTTTAAAGGCCATACCGAAGAGACCCCACTTGAAGAGAGACAGACCGTTTCAGTGGACA
AGAACAACTTTGAAGCGGTTATGCGTGAAAGCGATTTGAAACTGACCACTACAGTGCGCAATAAACTGAG
TGGCGATGAAAATGCTGAGCTTCCTGTTGAGCTTAGTTTCAAATCTCTTGCTGACTTCGAACCGGATTCA
GTGGCAGCACAAGTTCCAGAATTAAATAAATTGGTTGAGCTACGCCAAGCTCTTGTGGCCTTAAAAGGTC
CTTTGGGCAATATTCCCGCGTTTAGAGAGCGTCTACAAGAGCTACTAAATTCGGAAGAATCGCGTGAAAA
ACTTCTATCTGAGCTCAGTCTAGTGAGCGGCAAAGAAGAAGAGCCTCAAGCATAA
 Primer design