SecReT6
Protein ID: 537457115
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17345
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]611489..612967 [+]
Producttype VI secretion protein
NoteTssC
UniProt IDT1Y579
KEGG IDlag:N175_17345
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-189, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|537457115|ref|YP_008489776.1| type VI secretion protein [Listonella anguillarum M3]
MMSTTEAVLERQSATQGSLLDEIMAQTRIAPTEEGYDVAKKGVAAFIENLIGSNQTEEPVNKSLVDQMLV
ELDKKISAQMDEILHEERFQQMESSWRGLKLFIDRTDFRENNKVDLLHVTKGELLEDFEFAPETTQSGLY
KHVYSSGYGQFGGEPTGAIIGNFAFTPSTPDMKLLQYMGALGAMAHAPFISSVGPEFFGIDSFEELPNIK
DLKSTFESPKYTKWRSLRESEDARYLGLTAPRFLLRVPYDPTENPIKSFNYVESVSASHEHYLWGNTAFA
FATRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVFESMGALQSKIPTEVLVTDRKEFELAEEGFIALTMR
KGSDNAAFFSANSIQKPKIFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLE
RELNGWIKQYVADQENPPADVRSRRPLRAAKIEVMDVEGEPGWYQVSLSVRPHFKYMGANFELSLVGRLD
QA
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|537456627|ref|NC_022224.1|:611489-612967 Listonella anguillarum M3 chromosome 2, complete sequence
TTGATGTCTACTACTGAAGCCGTCTTAGAGAGACAAAGTGCCACCCAAGGCAGTTTACTTGATGAAATCA
TGGCACAAACGCGCATTGCACCGACTGAAGAAGGGTATGATGTTGCGAAGAAAGGGGTTGCTGCGTTTAT
TGAGAATCTCATCGGTTCGAATCAAACGGAAGAGCCAGTTAACAAATCACTCGTTGATCAAATGCTGGTT
GAGCTTGATAAGAAAATCAGTGCTCAAATGGATGAGATTTTGCACGAAGAGCGTTTCCAGCAGATGGAAT
CGTCATGGCGTGGTTTGAAACTGTTTATTGACCGTACCGATTTTCGTGAAAACAACAAGGTTGATTTGTT
GCATGTAACGAAAGGCGAGTTGCTTGAAGACTTTGAATTTGCACCAGAAACGACGCAATCCGGTCTTTAT
AAGCACGTTTATTCTTCTGGTTATGGCCAATTTGGTGGTGAGCCGACTGGCGCTATCATCGGTAACTTTG
CTTTCACGCCATCAACCCCTGACATGAAGCTACTGCAATACATGGGTGCACTTGGTGCGATGGCTCATGC
TCCATTCATTTCTAGTGTCGGCCCTGAGTTTTTTGGTATCGATTCTTTTGAAGAGCTACCAAATATCAAG
GATCTTAAGTCAACATTTGAAAGCCCTAAATACACTAAATGGCGTTCTCTACGTGAATCAGAAGATGCGC
GTTACCTTGGCTTGACTGCGCCTCGTTTCTTATTGCGCGTACCTTATGATCCAACAGAAAACCCAATTAA
ATCATTTAATTATGTGGAAAGTGTCAGCGCTTCACACGAACACTATCTATGGGGTAACACCGCGTTTGCT
TTCGCTACTCGTTTAACCGATAGCTTTGCCAAGTACCGTTGGTGTCCAAACATCATTGGCCCACAAAGTG
GCGGTGCGGTTGAAGATCTGCCAGTACACGTGTTTGAATCGATGGGTGCACTGCAAAGTAAGATCCCAAC
TGAAGTGTTGGTGACTGACCGTAAAGAGTTTGAATTAGCAGAAGAAGGTTTCATTGCTTTAACCATGCGT
AAAGGCAGTGATAACGCCGCATTCTTCTCTGCAAACTCGATCCAAAAGCCAAAAATATTCCCTAATACCA
AAGAAGGCAAAGAAGCGGAAACCAACTACAAGTTGGGTACGCAACTGCCATATATGATGATCATCAATCG
CCTTGCACACTACGTCAAAGTGCTACAGCGTGAGCAAATTGGTGCTTGGAAAGAGCGTCAAGATCTTGAA
CGTGAGCTTAATGGCTGGATCAAACAGTACGTGGCTGACCAAGAAAATCCACCAGCAGACGTACGTAGCC
GTCGTCCTCTTCGTGCTGCAAAAATCGAAGTCATGGATGTTGAAGGTGAACCAGGTTGGTATCAGGTCTC
TCTCTCTGTTCGTCCTCACTTTAAGTACATGGGCGCGAACTTTGAATTGTCATTGGTTGGTCGATTAGAT
CAAGCATAA
 Primer design