SecReT6
Protein ID: 537457116
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17350
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]612970..613407 [+]
Productlysozyme
NoteTssE
UniProt IDT1Y436
KEGG IDlag:N175_17350
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-17, Aligned region: 37..127
Protein Sequence: 145 a.a.     [Download]
>gi|537457116|ref|YP_008489777.1| lysozyme [Listonella anguillarum M3]
MTYIAPEESAFGVGFFERLEAGTKPMSLTQGPNAWDVLQSIKRNVSNILNTRMGEAQSAPTLGLVDFNDA
TLETLDLSLRIKLAIQSCLDVYEPRLRNIVIRSESDVFSPLMLRFHIVAEINSDALHEKVQFNLLLDQNR
KYRVY
 
Nucleotide Sequence: 438 bp     [Download]
>gi|537456627|ref|NC_022224.1|:612970-613407 Listonella anguillarum M3 chromosome 2, complete sequence
ATGACTTATATTGCACCTGAAGAGAGTGCATTTGGTGTCGGCTTCTTTGAACGTTTAGAAGCTGGCACCA
AGCCTATGTCTTTGACCCAAGGGCCAAATGCATGGGATGTGCTCCAATCAATCAAACGCAATGTTTCCAA
TATTTTGAATACTCGCATGGGTGAGGCACAAAGTGCTCCAACGTTAGGTTTAGTGGATTTTAACGATGCA
ACGTTAGAAACCTTAGACTTATCGCTGCGGATTAAGCTTGCGATACAAAGCTGCTTAGATGTGTATGAGC
CCCGTTTACGAAATATTGTGATTCGATCCGAGTCGGACGTGTTTAGCCCTTTGATGCTGCGCTTCCATAT
TGTGGCCGAAATAAACAGTGATGCGTTACATGAGAAAGTGCAGTTCAACCTGCTACTGGATCAAAACCGA
AAGTACCGAGTGTATTAG
 Primer design