SecReT6
Protein ID: 537457117
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17355
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]613414..615183 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDT1Y315
KEGG IDlag:N175_17355
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-205, Aligned region: 5..589
Protein Sequence: 589 a.a.     [Download]
>gi|537457117|ref|YP_008489778.1| type VI secretion protein [Listonella anguillarum M3]
MAQDKYFREELAFLKEQGKHFTEIHPQLSRFLHGKTTDPDVERLLEGFAFLTARLREKVEDEFPELTHSI
INMLWPNYLRPVPSMSIVSFTPDKSVSDKQQIARGTQLDSKPVFGTKCHFRTCRDVQIYPLKCTDVTAQH
TREATIIEVSLNMLGEISVGDAHLDDLRFYLGGDKYSSQMLYLWLNHYLDKISVEVAGVEFTLPRNSFQT
VGFDSEQSLLPYPSNVYEGYRVLQEYLSFPEAFHFVDITRLASVVPKSVHGAFKLKISFSKTLPADVRVR
QDNFQLYCTPVINLFEHDADPIDLTGKRSEYRIIPSSRYPSHYEVFSVDGVFGWQDKTQASQRIRGEKRV
YSAFESFQHEVERVRNREALYYRTRVRDSIRGDGFDNFISFIRGDETQSMHVDEAISLKLTCTNRLLPLE
LGVGDICEPTDSSPPFATFSNITVPSQSLRPVLDGSLLWVLISNLSLNYLSLLSKDALSSVLRAYDFRAL
VDRQAERVARLRLEGIQKIESQPVDKILRGLPVRGLQSTIHIDQNCFGSEGELYLFGTVLSHFFALYASI
NSFHELIVINASNQEKYTWGTQTGMQPLI
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|537456627|ref|NC_022224.1|:613414-615183 Listonella anguillarum M3 chromosome 2, complete sequence
ATGGCTCAAGATAAGTACTTCAGAGAAGAGCTTGCTTTCCTTAAAGAACAAGGAAAGCATTTCACTGAAA
TTCATCCTCAACTCTCTCGCTTTTTACACGGTAAAACGACGGATCCTGATGTCGAACGTTTATTGGAAGG
CTTCGCCTTTCTCACCGCTCGCTTGCGCGAAAAAGTTGAAGATGAATTTCCTGAGCTAACGCACTCCATC
ATCAACATGCTATGGCCAAACTACTTACGTCCTGTGCCAAGCATGAGTATTGTCTCGTTCACACCGGATA
AAAGTGTCAGTGATAAGCAGCAAATCGCTCGTGGCACTCAGCTCGATAGCAAGCCTGTTTTCGGCACCAA
ATGTCACTTTAGAACCTGTCGTGACGTGCAGATTTACCCACTGAAATGTACTGACGTCACTGCGCAACAT
ACTAGAGAAGCGACCATCATCGAAGTGTCGCTTAATATGTTGGGTGAGATAAGCGTCGGTGATGCGCATC
TTGATGATCTGCGCTTTTACTTAGGTGGTGATAAATACAGCTCACAAATGCTCTATCTATGGCTCAACCA
CTACCTCGATAAGATTTCTGTTGAAGTCGCGGGGGTAGAATTTACGCTGCCGCGCAATAGCTTCCAAACG
GTCGGATTTGATAGCGAGCAGTCGCTTTTGCCCTATCCTTCCAATGTGTACGAAGGTTATCGCGTTTTAC
AGGAATACTTGTCGTTTCCTGAAGCATTTCACTTTGTTGACATTACCCGTCTGGCTAGCGTAGTGCCGAA
ATCAGTGCATGGTGCGTTCAAACTGAAAATCAGTTTTTCGAAAACCCTGCCAGCGGACGTTCGAGTGCGT
CAGGATAATTTCCAGTTGTACTGCACCCCTGTCATTAATTTGTTTGAACATGATGCCGATCCTATCGATT
TAACGGGCAAGCGTTCAGAGTATCGCATTATTCCCTCTAGTCGTTATCCTTCTCACTATGAAGTGTTCAG
CGTTGACGGCGTGTTCGGTTGGCAAGACAAAACTCAAGCCAGCCAACGAATTCGGGGTGAAAAACGTGTC
TATTCAGCATTTGAAAGTTTTCAGCATGAAGTGGAGCGGGTTCGAAATCGTGAAGCGCTCTACTACCGCA
CACGAGTGAGAGACAGTATCCGTGGCGATGGATTTGATAATTTCATCTCTTTCATTCGCGGAGATGAAAC
GCAATCCATGCATGTCGATGAAGCCATCTCGCTCAAACTCACCTGCACCAATCGCTTATTACCGCTCGAA
CTCGGTGTCGGTGACATTTGTGAGCCGACAGACAGCTCGCCCCCCTTTGCCACTTTCAGCAATATTACCG
TGCCTTCACAATCTCTGCGCCCAGTACTGGATGGCAGTCTATTGTGGGTATTGATTTCTAACTTATCGCT
GAATTATTTATCGCTGCTGTCCAAAGATGCCTTAAGCAGTGTGTTGCGAGCTTACGATTTCAGAGCCTTG
GTGGATCGCCAAGCGGAGCGTGTTGCGCGTTTGCGTCTTGAAGGGATCCAAAAAATTGAGTCGCAACCCG
TGGATAAAATATTGCGCGGTTTGCCAGTGCGAGGCCTGCAATCGACGATTCATATTGATCAAAACTGTTT
TGGTTCAGAAGGGGAGCTTTACCTCTTTGGCACAGTGCTTAGCCACTTTTTTGCCCTATATGCCAGCATC
AATTCGTTTCATGAGCTGATCGTTATTAACGCGTCCAATCAAGAGAAGTACACATGGGGAACACAGACAG
GAATGCAGCCATTGATCTAG
 Primer design