SecReT6
Protein ID: 537457118
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17365
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]616174..617646 [+]
Productsignal peptide protein
NoteFha
UniProt IDT1Y3P3
KEGG IDlag:N175_17365
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.60E-09, Aligned region: 33..100
Protein Sequence: 490 a.a.     [Download]
>gi|537457118|ref|YP_008489780.1| signal peptide protein [Listonella anguillarum M3]
MQKKQTLSMVVTNVQLLESGLSAQAMFNVQGGVIGSASDAHWQLRDGKGKIQNHHCAIRVIDGAFCIQDL
VGNTYVNGSHKPLGQGASAKLEHKDEVAIGPYQIRVIFGQVGEDDSLINGSLDQLFAKEGLDLLKDGPLD
DISRDEDEPEPSSMDPIAALDDLLQGIKQEESLLEETEKPLAQAQHSLVPEYDSQQSQLQFTPQADSEYE
MTSSIRLKKILGFGKTSTDLPPIPAVEHHETAQPPTHLNINNSIYNVPEGLAMDDKVLDLLEEEVARSYH
PHSEQHNSSSNNASHLLTGPMLTGLGVDVGNSHDMAKMHMLSEELGQSLQACVQGLLELHQQVSEGRFGM
MNRNLQPIEDNPLRLGLSYEETIRTLYDADKSVVHLSAPAAIAESLKNVRDHNEAMQHATSEALNQILNA
FSPQVLLRRFQHYKRNSDAQSNSSDAWAWEMYCHYYQELTSNRQKGFEKLFWEIFEQSYDKKIREKQLEL
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|537456627|ref|NC_022224.1|:616174-617646 Listonella anguillarum M3 chromosome 2, complete sequence
ATGCAGAAGAAGCAAACGCTTTCAATGGTAGTGACGAATGTGCAACTACTGGAATCAGGATTATCCGCAC
AAGCGATGTTTAATGTGCAAGGCGGTGTGATTGGCTCTGCAAGTGATGCGCATTGGCAGCTTCGTGACGG
TAAAGGGAAAATTCAAAATCATCACTGTGCAATCCGTGTGATTGATGGTGCGTTTTGCATTCAAGATCTG
GTTGGTAATACCTATGTTAATGGTTCCCATAAGCCGTTAGGGCAAGGTGCTTCGGCTAAGTTGGAGCATA
AAGATGAAGTGGCCATTGGACCTTACCAAATTCGTGTCATTTTTGGTCAAGTGGGTGAAGATGATTCTCT
GATTAATGGCTCTTTGGATCAGCTGTTTGCTAAAGAGGGGCTCGATCTACTCAAAGATGGTCCATTGGAT
GATATCAGCCGCGACGAGGATGAACCAGAGCCGAGTTCAATGGACCCTATCGCCGCTTTAGATGATTTAT
TGCAAGGCATTAAACAAGAAGAGTCGTTGCTTGAAGAGACGGAAAAACCACTCGCACAAGCACAACATTC
ATTAGTGCCAGAATACGATAGCCAGCAGTCGCAACTGCAGTTTACGCCTCAAGCTGACAGCGAGTATGAG
ATGACGTCATCGATTCGATTAAAGAAAATTCTCGGTTTTGGCAAAACCTCCACCGATTTACCACCTATTC
CGGCTGTTGAGCACCATGAGACTGCGCAACCACCGACTCATTTGAACATTAATAACAGCATTTACAACGT
ACCTGAGGGCTTAGCGATGGACGATAAAGTATTAGATCTACTTGAGGAAGAAGTGGCGAGAAGCTACCAC
CCTCACTCCGAGCAACACAACAGCTCGTCAAACAATGCATCACACTTATTGACCGGCCCCATGCTCACCG
GGCTAGGTGTTGACGTTGGCAATAGCCACGATATGGCGAAAATGCACATGCTTTCAGAAGAGCTTGGGCA
ATCGTTGCAAGCTTGTGTGCAAGGTTTGCTTGAGCTTCACCAGCAAGTGAGTGAAGGGCGTTTTGGTATG
ATGAATCGTAACTTGCAACCGATTGAAGATAACCCACTTCGCTTGGGGCTATCATACGAAGAAACCATTC
GTACTCTGTATGATGCTGATAAAAGTGTGGTGCACTTGTCTGCCCCAGCGGCGATTGCCGAAAGCCTAAA
AAATGTGCGCGATCATAACGAAGCAATGCAGCACGCCACTAGCGAAGCCCTAAATCAGATTCTTAATGCC
TTTTCTCCTCAAGTGCTACTGCGCCGTTTCCAACACTACAAGCGCAATAGTGATGCACAGAGTAACTCTT
CAGATGCTTGGGCGTGGGAGATGTATTGCCACTACTACCAAGAGCTCACTTCTAATCGCCAAAAAGGATT
TGAGAAACTGTTTTGGGAAATTTTCGAGCAGTCTTACGACAAGAAAATTCGTGAAAAACAGCTGGAGCTA
TAA
 Primer design