SecReT6
Protein ID: 537457119
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17370
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]617649..618128 [+]
Producttype VI secretion protein
NoteTssJ
UniProt IDT1Y4R3
KEGG IDlag:N175_17370
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-37, Aligned region: 13..150
Protein Sequence: 159 a.a.     [Download]
>gi|537457119|ref|YP_008489781.1| type VI secretion protein [Listonella anguillarum M3]
MNKRSFVLLMLLTVLTACSSSEKYEPATQPTKVTFSLVSDEGTNPNIWGEASPIEVQVFELKDDSMFMSA
DYDQVKADYKKALRSNFIANYDYVMTPGQFKFVNAFEIDEGTNYIGVMAHFAEPELSEWKKAVKVLNKGR
EYHLLMYFKDYDVKLERVE
 
Nucleotide Sequence: 480 bp     [Download]
>gi|537456627|ref|NC_022224.1|:617649-618128 Listonella anguillarum M3 chromosome 2, complete sequence
GTGAACAAGCGGTCTTTTGTCCTGCTGATGCTACTGACGGTATTAACCGCCTGTAGCTCATCAGAAAAGT
ATGAGCCAGCCACACAGCCGACCAAGGTAACGTTCAGTCTCGTTAGTGATGAAGGTACTAACCCCAATAT
TTGGGGTGAAGCGTCGCCGATAGAGGTTCAAGTGTTTGAGCTCAAAGATGATTCGATGTTTATGTCTGCC
GATTATGACCAAGTAAAAGCAGACTACAAAAAAGCGTTACGCAGCAATTTTATCGCCAATTACGATTATG
TAATGACACCAGGCCAGTTTAAGTTTGTGAACGCGTTCGAGATTGATGAAGGCACGAACTACATTGGGGT
CATGGCGCATTTTGCTGAACCTGAGCTGAGTGAATGGAAAAAGGCCGTCAAAGTGCTTAACAAAGGTAGG
GAATACCATCTTTTGATGTATTTCAAAGACTACGATGTAAAACTGGAAAGGGTGGAATAA
 Primer design