SecReT6
Protein ID: 537457120
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17375
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]618133..619467 [+]
Producthypothetical protein
NoteTssK
UniProt IDT1Y583
KEGG IDlag:N175_17375
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.80E-161, Aligned region: 19..443
GMP_synt_C [PF00958], Evalue: 0.00037, Aligned region: 120..137
GMP_synt_C [PF00958], Evalue: 0.00037, Aligned region: 303..374
Protein Sequence: 444 a.a.     [Download]
>gi|537457120|ref|YP_008489782.1| hypothetical protein N175_17375 [Listonella anguillarum M3]
MFARNRVIWNEGLFIKPQHFQQQQRYFEYHIDERISSVSGYLYGVSELSLNPEYLSFGRIAIERAVGIMP
DGTVFRIPQEDVLPDALEIADASLANQLVYLAVPLRSESLMEINWPEERGTGRYLSNRLEVRDVHTVRGD
TTTLDVSPVRVQLMLEKEDRSSYASIAIARILEKRPDGSVVLDPDFIPCHLNVASNAALHRFINEISGLM
RERAKNIAQRISSPSQGGVADVSDFMLLQALNRLQPQMQHLAELRSLHPERLFECLSCVCGELATFTDES
RLPPSIPSYNHEMPTHSFGPLIRNLRQSLSIVLEPRAVSIQLDKRKYGLMVAPIHDPQLVESAEFIIAVK
ARMPLDELRRLFTQQTKVSSVEKIRELISLQLPGIPITPLPVAPRQLPYHAGYTYYQLDKTSSAWSMLGR
SSGFAFHVAGAFEDLDLQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|537456627|ref|NC_022224.1|:618133-619467 Listonella anguillarum M3 chromosome 2, complete sequence
ATGTTTGCGCGTAATCGTGTCATTTGGAATGAAGGTCTATTCATTAAACCGCAGCATTTCCAGCAGCAGC
AACGCTATTTTGAATATCATATTGATGAACGCATCTCATCAGTCAGTGGCTATCTTTACGGAGTATCAGA
GTTATCACTTAACCCTGAATATCTCTCTTTTGGTCGTATCGCGATCGAACGTGCGGTCGGCATTATGCCT
GATGGAACCGTTTTCCGTATTCCTCAGGAAGATGTGTTGCCCGATGCGCTTGAGATTGCCGATGCTTCGC
TTGCAAACCAGTTGGTCTATTTAGCGGTGCCACTTCGCAGTGAATCGTTAATGGAGATTAACTGGCCCGA
AGAGCGTGGAACAGGGCGTTACTTAAGCAATCGTTTAGAAGTGCGTGATGTGCATACCGTGCGCGGTGAC
ACCACGACGCTAGATGTCTCACCTGTTCGTGTGCAGTTGATGCTTGAAAAAGAAGACAGAAGCTCTTACG
CCTCAATCGCGATCGCTCGTATTTTAGAAAAACGTCCTGATGGCAGTGTCGTGCTCGATCCGGATTTTAT
TCCGTGCCATCTTAATGTTGCGAGCAATGCGGCTTTGCACCGTTTTATTAACGAAATATCTGGGTTAATG
CGCGAACGTGCCAAAAATATTGCTCAACGTATCAGCTCTCCCTCTCAAGGCGGGGTCGCGGATGTGTCTG
ATTTTATGCTGTTGCAAGCCCTGAATCGCTTACAACCCCAGATGCAACACTTGGCAGAGCTACGCAGTTT
GCACCCGGAACGTTTATTTGAGTGCCTGTCATGCGTATGTGGAGAATTGGCTACATTTACCGATGAAAGT
CGTTTACCACCGAGCATCCCGAGCTACAACCATGAAATGCCGACCCACTCTTTTGGGCCGCTGATCCGCA
ACTTAAGACAGAGCCTAAGTATCGTACTTGAGCCTAGAGCGGTCTCGATTCAGTTGGATAAACGTAAGTA
CGGCCTGATGGTTGCCCCAATCCACGACCCTCAACTAGTTGAAAGCGCAGAATTCATCATCGCGGTGAAA
GCACGCATGCCATTAGATGAACTGCGTCGTCTCTTTACTCAGCAGACCAAAGTATCGTCAGTGGAGAAAA
TCCGCGAGCTCATTTCACTGCAATTACCGGGTATTCCAATTACACCGTTACCAGTTGCACCAAGGCAGTT
GCCTTACCACGCCGGTTATACCTATTACCAATTGGATAAAACCAGCTCAGCATGGTCGATGTTAGGTCGC
TCAAGTGGTTTTGCTTTCCATGTCGCGGGTGCGTTTGAAGATCTTGACCTGCAATTCTGGGCGATTAGGA
GCTGA
 Primer design