SecReT6
Protein ID: 537457121
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17380
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]619467..620243 [+]
Producttype IV / VI secretion system , DotU family domain protein
NoteTssL
UniProt IDT1Y443
KEGG IDlag:N175_17380
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.70E-70, Aligned region: 38..243
HHA [PF05321], Evalue: 0.0024, Aligned region: 16..28
HHA [PF05321], Evalue: 0.0024, Aligned region: 52..88
HHA [PF05321], Evalue: 0.0024, Aligned region: 176..207
Protein Sequence: 258 a.a.     [Download]
>gi|537457121|ref|YP_008489783.1| type IV / VI secretion system , DotU family domain protein [Listonella anguillarum M3]
MMAIDKKNTQYSGLLFDSVEQINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRSLSECENIEQIYKQT
VEEIKAIEIELAEQGFEHAILMAYRYILCAFLDEAVMGTEWGASSVWAEHSMLSRFHSETWGGEKVFTIL
SRLEGEPKRYRALLEFIYQCLVLGFEGKYRVMESGHNEREKVISRLHDTVSSLDENEPKELTSATDHVVK
SKYKLSRQLPVWSVLLGFVIIWVGVFLGYSYLLHSQSADVLNQLNQIL
 
Nucleotide Sequence: 777 bp     [Download]
>gi|537456627|ref|NC_022224.1|:619467-620243 Listonella anguillarum M3 chromosome 2, complete sequence
ATGATGGCCATTGATAAAAAAAACACCCAATACAGCGGTCTGCTTTTTGACAGCGTCGAGCAGATCAACC
ACGACCAAGATTACTGGTTTCAACTGCGTGGTGATAACCCTAATGTTTTGATTGATGCTGCTACCCCTCT
GTTTGGTTTGTCGCTGCGGGTACGCAGCTTGTCAGAGTGCGAAAACATTGAGCAGATCTACAAACAGACG
GTGGAAGAGATTAAAGCGATTGAAATCGAGCTTGCCGAGCAAGGGTTTGAGCATGCGATTTTGATGGCTT
ATCGCTACATTCTGTGCGCGTTTTTGGATGAAGCCGTCATGGGAACCGAGTGGGGTGCATCTAGTGTGTG
GGCTGAACATTCTATGCTGTCTCGTTTCCACAGTGAGACTTGGGGCGGCGAAAAAGTGTTTACCATCTTA
AGTCGCTTGGAAGGTGAACCTAAACGTTATCGCGCGTTGCTAGAGTTTATCTATCAATGCCTAGTGTTAG
GTTTTGAAGGTAAATACCGTGTGATGGAAAGCGGCCACAACGAGCGTGAAAAGGTGATCAGTCGTTTACA
TGACACCGTCAGTTCGTTGGATGAAAACGAGCCGAAAGAACTGACCTCCGCCACCGACCATGTGGTGAAA
TCAAAATATAAGTTAAGCAGGCAGTTACCGGTTTGGTCAGTGCTGCTTGGTTTTGTCATTATTTGGGTCG
GTGTGTTTTTAGGCTATTCCTATTTACTGCACAGCCAATCGGCAGACGTATTAAACCAATTGAACCAAAT
ACTCTAA
 Primer design