SecReT6
Protein ID: 537457122
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17385
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]620258..622885 [+]
ProductATPase AAA
NoteTssH
UniProt IDT1Y321
KEGG IDlag:N175_17385
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.20E-40, Aligned region: 613..775
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 226..357
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 619..737
ClpB_D2-small [PF10431], Evalue: 2.60E-14, Aligned region: 780..853
AAA_5 [PF07728], Evalue: 5.90E-13, Aligned region: 226..246
AAA_5 [PF07728], Evalue: 5.90E-13, Aligned region: 618..736
AAA_16 [PF13191], Evalue: 8.10E-11, Aligned region: 81..120
AAA_16 [PF13191], Evalue: 8.10E-11, Aligned region: 204..241
AAA_16 [PF13191], Evalue: 8.10E-11, Aligned region: 270..304
AAA_16 [PF13191], Evalue: 8.10E-11, Aligned region: 368..400
AAA_16 [PF13191], Evalue: 8.10E-11, Aligned region: 502..542
AAA_16 [PF13191], Evalue: 8.10E-11, Aligned region: 589..659
AAA_16 [PF13191], Evalue: 8.10E-11, Aligned region: 773..800
AAA_22 [PF13401], Evalue: 2.20E-09, Aligned region: 225..318
AAA_22 [PF13401], Evalue: 2.20E-09, Aligned region: 482..500
AAA_22 [PF13401], Evalue: 2.20E-09, Aligned region: 615..706
AAA_25 [PF13481], Evalue: 3.60E-07, Aligned region: 226..250
AAA_25 [PF13481], Evalue: 3.60E-07, Aligned region: 282..323
AAA_25 [PF13481], Evalue: 3.60E-07, Aligned region: 611..651
AAA_25 [PF13481], Evalue: 3.60E-07, Aligned region: 787..816
Clp_N [PF02861], Evalue: 1.60E-06, Aligned region: 27..75
AAA_14 [PF13173], Evalue: 3.90E-05, Aligned region: 226..329
AAA_14 [PF13173], Evalue: 3.90E-05, Aligned region: 618..700
AAA_14 [PF13173], Evalue: 3.90E-05, Aligned region: 791..819
DUF258 [PF03193], Evalue: 5.50E-05, Aligned region: 193..243
DUF258 [PF03193], Evalue: 5.50E-05, Aligned region: 618..659
Arch_ATPase [PF01637], Evalue: 7.40E-05, Aligned region: 206..240
Arch_ATPase [PF01637], Evalue: 7.40E-05, Aligned region: 278..312
Arch_ATPase [PF01637], Evalue: 7.40E-05, Aligned region: 366..396
Arch_ATPase [PF01637], Evalue: 7.40E-05, Aligned region: 618..658
NACHT [PF05729], Evalue: 0.0002, Aligned region: 226..254
NACHT [PF05729], Evalue: 0.0002, Aligned region: 376..451
NACHT [PF05729], Evalue: 0.0002, Aligned region: 619..647
DUF815 [PF05673], Evalue: 0.00021, Aligned region: 222..301
DUF815 [PF05673], Evalue: 0.00021, Aligned region: 569..652
AAA_29 [PF13555], Evalue: 0.00027, Aligned region: 219..243
AAA_29 [PF13555], Evalue: 0.00027, Aligned region: 614..630
IstB_IS21 [PF01695], Evalue: 0.0003, Aligned region: 220..284
IstB_IS21 [PF01695], Evalue: 0.0003, Aligned region: 617..638
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 223..247
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 373..403
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 617..640
AAA_17 [PF13207], Evalue: 0.00075, Aligned region: 226..273
AAA_17 [PF13207], Evalue: 0.00075, Aligned region: 471..471
AAA_17 [PF13207], Evalue: 0.00075, Aligned region: 619..653
Sigma54_activat [PF00158], Evalue: 0.0012, Aligned region: 224..240
Sigma54_activat [PF00158], Evalue: 0.0012, Aligned region: 615..716
Miro [PF08477], Evalue: 0.0035, Aligned region: 227..243
Miro [PF08477], Evalue: 0.0035, Aligned region: 619..641
RNA_helicase [PF00910], Evalue: 0.0041, Aligned region: 227..247
RNA_helicase [PF00910], Evalue: 0.0041, Aligned region: 619..641
Ras [PF00071], Evalue: 0.0045, Aligned region: 226..239
Ras [PF00071], Evalue: 0.0045, Aligned region: 618..660
AAA_18 [PF13238], Evalue: 0.0066, Aligned region: 226..245
AAA_18 [PF13238], Evalue: 0.0066, Aligned region: 619..658
MobB [PF03205], Evalue: 0.0079, Aligned region: 226..246
MobB [PF03205], Evalue: 0.0079, Aligned region: 619..640
AAA_11 [PF13086], Evalue: 0.0091, Aligned region: 348..492
AAA_11 [PF13086], Evalue: 0.0091, Aligned region: 615..641
Protein Sequence: 875 a.a.     [Download]
>gi|537457122|ref|YP_008489784.1| ATPase AAA [Listonella anguillarum M3]
MIVVIRIELPTLISKLNEQSKLALEQAASLCIERQHPEVTYEHFLHVLLENPLSDVRVIAKHANLDVETV
KQAISASYAREQVLDTYPAFSPLLVELLQEAWLLSTTELNQNQLRSGVVFLAALMRADRYLPLKLIRLFE
HINKESLNKGFDTLLQDSSESAVEKSKAGSQAPAALDAASSSPLHKYCTNVTAQARNGELDPVLCRENEL
NLMIDILCRRRKNNPIVVGDAGVGKSAMIEGLALRVVAGNVPTQLQNVELCSLDLGLLQAGASVKGEFEK
RLKGVIDAIKTSPKPIILFIDEAHTLIGSGNQEGGSDAANLLKPALARGELSTVAATTWKEYKKYFEKDP
ALTRRFQLVKLEEPSISQAVDILRGLNRVYEKAHNVLITDDALKAAAELSARYISGRQLPDKAIDVLDTA
CARIAINITTPPKRLAQLETACHQRQLEIDMLERAQYLGQVVDSHRLDELCSQEVADEAEKATLTQSWQE
QKAIIERIITLRDQLLDGAEDHGEQTQVERDELLVQLQEQYRALEEIPHNDRLMHPQVDAQQIAEVIADW
TGVPVDQMNSDELHKITHLTAILGEAIKGQDTAIERVHRNLLTARADLRRPGRPKGSFLLVGPSGVGKTE
TVVQLAQQLYGGKQFLTTINMSEYQEKHTVSRLIGSPPGYVGYGEGGILTEAIRKMPYSVVLLDEVEKAH
PEVLNIFYQAFDKGELADGEGRVIDCQNIVFFLTSNLGYQTIVDYAQQPQLLDEQLYPELAAFFKPALLA
RMEIIPYLPLSKEVLEQIVRGKLTRLEQLFKQRYAADVVIEDSLIEEILSRATRSENGARMLEAIIEGQL
LPPISLALLNKLADKQPVQRIYLAAEEGEFIGEVE
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|537456627|ref|NC_022224.1|:620258-622885 Listonella anguillarum M3 chromosome 2, complete sequence
GTGATTGTAGTGATCCGTATTGAATTACCCACATTAATTTCAAAACTCAATGAACAGAGTAAGCTAGCCC
TAGAGCAAGCCGCTTCATTATGTATTGAACGTCAGCACCCAGAAGTGACCTATGAGCACTTCTTACATGT
GTTGCTAGAGAACCCACTTTCGGATGTGCGTGTGATAGCTAAGCACGCTAACTTAGATGTGGAAACCGTA
AAACAAGCCATCAGTGCAAGTTACGCTCGTGAACAAGTGTTAGATACCTATCCAGCATTCTCGCCACTGT
TGGTTGAGCTATTGCAGGAAGCTTGGTTGCTTTCTACCACTGAGCTGAATCAGAATCAGCTTCGTTCAGG
TGTGGTGTTTTTAGCCGCGTTGATGCGCGCTGATCGTTACCTACCACTTAAACTAATCCGTCTTTTTGAA
CACATCAACAAAGAGAGCCTAAACAAAGGGTTTGATACGCTGTTGCAAGACTCTTCCGAGTCGGCGGTTG
AAAAAAGCAAAGCGGGTTCTCAAGCTCCTGCCGCGCTGGATGCAGCGTCATCTTCGCCACTGCATAAATA
CTGCACCAATGTCACGGCGCAAGCGCGTAACGGCGAACTGGACCCAGTATTGTGTCGTGAAAACGAACTC
AATTTGATGATCGACATCTTGTGTCGTCGTCGTAAAAACAACCCCATCGTTGTGGGAGACGCTGGTGTCG
GTAAAAGCGCCATGATTGAAGGGCTTGCATTGCGCGTCGTTGCGGGCAATGTGCCGACACAGTTGCAAAA
TGTAGAGTTGTGCTCACTCGATCTAGGCTTGTTACAAGCGGGTGCTTCGGTCAAAGGTGAATTTGAAAAA
CGTCTTAAAGGCGTGATTGACGCGATCAAAACCTCGCCTAAACCGATCATTTTGTTTATCGATGAAGCGC
ACACTTTAATTGGTTCTGGCAACCAAGAGGGTGGTAGTGATGCGGCCAACTTGCTCAAGCCAGCTCTTGC
GCGAGGCGAGCTCAGTACTGTCGCAGCCACCACATGGAAAGAGTACAAAAAGTATTTTGAAAAAGATCCT
GCGCTGACTCGTCGTTTCCAGTTAGTGAAATTAGAAGAGCCGAGCATCAGCCAAGCAGTAGATATTCTGC
GTGGCTTGAATCGTGTTTACGAAAAAGCCCATAACGTATTGATTACTGATGATGCATTGAAAGCCGCCGC
CGAGCTTTCAGCGCGTTACATTTCAGGTAGACAACTGCCGGATAAAGCGATTGATGTGTTGGATACTGCT
TGCGCGCGTATTGCAATTAATATCACCACACCGCCGAAGCGCTTAGCGCAACTAGAGACCGCTTGCCATC
AACGTCAACTTGAAATTGATATGCTTGAGCGTGCTCAATATTTAGGTCAAGTGGTTGATTCGCATCGCTT
GGATGAGCTATGTAGCCAAGAAGTGGCCGATGAAGCTGAAAAAGCGACCTTGACTCAAAGCTGGCAAGAG
CAAAAAGCGATCATTGAGCGCATTATTACCCTACGCGATCAGCTCTTAGATGGCGCTGAGGATCATGGTG
AGCAGACCCAAGTTGAGCGCGATGAGTTACTTGTTCAATTGCAGGAGCAATATCGAGCTTTAGAAGAGAT
CCCTCATAATGATCGTCTCATGCATCCACAAGTCGATGCTCAGCAAATAGCGGAAGTGATTGCGGACTGG
ACGGGCGTGCCCGTTGACCAAATGAACAGCGATGAGCTGCATAAAATCACCCACCTAACGGCTATTTTAG
GTGAGGCAATCAAAGGGCAAGATACTGCAATTGAGCGTGTTCACCGTAACTTATTAACGGCGCGCGCGGA
TTTGCGCCGTCCGGGGCGTCCAAAAGGTTCCTTCCTACTCGTGGGTCCAAGTGGCGTTGGTAAAACCGAA
ACGGTAGTCCAACTGGCGCAACAACTTTATGGTGGTAAACAATTTTTAACCACTATCAACATGTCGGAAT
ATCAAGAAAAGCATACCGTTTCACGCCTGATTGGTTCGCCTCCGGGTTATGTTGGTTATGGTGAGGGTGG
CATTCTTACCGAAGCGATTCGTAAAATGCCGTACTCTGTGGTGCTGTTAGACGAAGTTGAAAAAGCGCAC
CCAGAAGTGCTCAATATTTTCTACCAAGCCTTTGATAAAGGTGAGCTGGCCGATGGTGAAGGTCGAGTGA
TCGACTGCCAAAACATCGTCTTCTTCCTCACCTCGAATTTAGGTTACCAAACCATAGTCGATTACGCGCA
GCAGCCTCAGTTGCTTGATGAGCAGCTTTACCCAGAACTTGCGGCTTTCTTCAAACCCGCCTTACTGGCT
CGTATGGAGATTATTCCGTATCTACCGCTCAGCAAAGAAGTGCTAGAGCAGATTGTGCGTGGCAAGTTAA
CCCGCCTTGAGCAGCTCTTTAAACAGCGTTATGCCGCTGACGTGGTGATTGAAGATAGCTTGATCGAAGA
GATCTTAAGCCGTGCCACGCGCTCTGAAAATGGGGCTCGTATGCTGGAAGCGATCATCGAAGGTCAATTA
CTACCACCGATTTCATTAGCTTTGTTAAATAAATTGGCTGATAAACAACCAGTGCAACGCATCTATTTAG
CGGCGGAAGAGGGTGAGTTTATTGGAGAGGTTGAGTGA
 Primer design