SecReT6
Protein ID: 537457123
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17390
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]622882..624450 [+]
ProductATPase AAA
NoteVasH
UniProt IDT1Y3P9
KEGG IDlag:N175_17390
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 2.10E-69, Aligned region: 195..361
Sigma54_activat [PF00158], Evalue: 2.10E-69, Aligned region: 413..449
Sigma54_activ_2 [PF14532], Evalue: 2.60E-24, Aligned region: 169..184
Sigma54_activ_2 [PF14532], Evalue: 2.60E-24, Aligned region: 196..366
AAA_5 [PF07728], Evalue: 7.90E-08, Aligned region: 219..338
AAA_5 [PF07728], Evalue: 7.90E-08, Aligned region: 368..385
HTH_8 [PF02954], Evalue: 8.30E-08, Aligned region: 349..359
HTH_8 [PF02954], Evalue: 8.30E-08, Aligned region: 479..517
Mg_chelatase [PF01078], Evalue: 8.00E-05, Aligned region: 211..244
Mg_chelatase [PF01078], Evalue: 8.00E-05, Aligned region: 274..316
AAA [PF00004], Evalue: 0.0044, Aligned region: 219..315
AAA_2 [PF07724], Evalue: 0.005, Aligned region: 217..313
T2SE [PF00437], Evalue: 0.0078, Aligned region: 192..245
Protein Sequence: 522 a.a.     [Download]
>gi|537457123|ref|YP_008489785.1| ATPase AAA [Listonella anguillarum M3]
MIMSHWLAYATELVVARKPSQLAALFVETLRRELRLDTCLLLVPSSDGRTLVPQDNPLNLSWSVTDFDCP
FAHVLQSAKSMHLTADELVFWQSNRLFSQLTSRVGMLDSVVVHPLPNGDTQVQSILLLIGETHTLEGLFE
QPDFIKYVDVFCHQWSLLNEMQREEQNRQSLSESLSDVQRDNARRSLIASLSETLIGNSLAMKKLREQII
NAAPSQLSVMVQGETGTGKELVAQAVHQLSPRKQAPFVAINCAAIPENLLESELFGYCKGAFSGADSDKQ
GLIAQADGGTLFLDEIGDMPLSLQAKLLRVLESRSFRPIGGKNEQSSDFRLVSATHVNLLEQVRNKSFRQ
DLYYRLFQYPITLPRLAARMDDIERLSQHFVRSFNQQHATNIRGVHYKAIDCLKRYDFPGNVRELKHLIE
FGCAQTLDGTQVEESCFTQRLAYTKADQQPETERHGHKVAKAEPGVSRVVDDLKQAVNEFESRIIRERLQ
YFAGDRAKAAQSLGIPKRTLAYKCQKLEIKTP
 
Nucleotide Sequence: 1569 bp     [Download]
>gi|537456627|ref|NC_022224.1|:622882-624450 Listonella anguillarum M3 chromosome 2, complete sequence
GTGATCATGAGTCACTGGTTAGCTTACGCAACCGAGCTTGTTGTCGCGAGAAAGCCTAGCCAATTGGCCG
CATTGTTTGTAGAAACGCTGCGCCGAGAGCTAAGGCTCGATACTTGCTTGTTACTGGTTCCCAGTTCAGA
CGGCCGTACCTTAGTGCCACAGGATAACCCGCTGAATTTAAGCTGGTCGGTCACCGATTTTGATTGTCCG
TTTGCCCATGTATTGCAATCGGCCAAATCGATGCACTTAACCGCTGATGAATTGGTTTTTTGGCAATCTA
ATCGCCTGTTTAGTCAACTCACTAGCCGGGTCGGCATGCTAGATAGCGTGGTTGTACACCCGTTACCGAA
TGGGGATACACAAGTTCAGTCTATTTTGCTGTTGATTGGTGAAACCCATACCTTGGAAGGCCTATTTGAG
CAGCCAGATTTTATCAAGTATGTGGATGTTTTTTGCCATCAGTGGTCGTTGCTTAATGAGATGCAACGGG
AAGAACAAAATCGACAAAGCTTATCGGAATCCTTGTCTGACGTTCAGCGTGACAATGCTCGTCGCTCATT
AATTGCGAGCCTCTCTGAAACCTTAATCGGTAACAGTTTGGCGATGAAAAAATTAAGAGAGCAGATCATC
AACGCCGCGCCATCACAGCTTTCAGTGATGGTGCAAGGTGAAACTGGGACAGGTAAAGAGTTGGTCGCGC
AAGCGGTGCACCAACTCTCGCCCCGTAAACAAGCGCCATTTGTTGCTATTAACTGCGCGGCTATCCCTGA
AAACTTATTGGAAAGTGAACTGTTCGGCTACTGCAAAGGGGCGTTTTCCGGCGCGGATAGCGATAAACAA
GGGTTGATTGCGCAAGCCGATGGCGGAACCCTGTTTTTGGATGAAATCGGTGATATGCCCTTGAGCCTGC
AAGCCAAATTACTGCGGGTGTTGGAATCTCGATCTTTTCGGCCGATTGGCGGTAAAAACGAACAATCTTC
TGATTTTCGTTTGGTTTCAGCAACGCATGTCAATCTCCTCGAACAAGTGCGTAATAAATCGTTTCGTCAG
GATCTTTATTACCGCTTATTTCAGTACCCGATCACTTTGCCACGCCTTGCGGCAAGGATGGATGACATTG
AACGGCTTAGCCAACATTTTGTGCGCAGCTTTAATCAGCAGCATGCAACCAACATTCGGGGTGTGCACTA
TAAAGCGATCGATTGCCTAAAACGTTATGACTTTCCCGGTAACGTGCGTGAACTCAAGCACCTTATTGAA
TTTGGTTGTGCGCAAACACTGGATGGCACACAGGTGGAGGAGTCCTGCTTTACACAACGTTTAGCATACA
CTAAAGCCGATCAGCAGCCAGAGACTGAACGACATGGGCATAAGGTCGCTAAAGCTGAGCCCGGTGTCAG
CCGAGTGGTGGATGATTTAAAACAAGCGGTGAATGAATTTGAGTCTCGTATTATCCGTGAGCGCCTCCAA
TACTTTGCTGGTGATAGGGCCAAAGCGGCCCAAAGCCTCGGTATTCCCAAGCGGACCTTGGCCTATAAAT
GCCAAAAATTGGAGATTAAAACACCATGA
 Primer design