SecReT6
Protein ID: 537457125
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17400
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]625116..626513 [+]
Producttype VI secretion protein
NoteTssA
UniProt IDT1Y589
KEGG IDlag:N175_17400
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-17, Aligned region: 49..109
FTA4 [PF13093], Evalue: 0.0077, Aligned region: 155..283
Protein Sequence: 465 a.a.     [Download]
>gi|537457125|ref|YP_008489787.1| type VI secretion protein [Listonella anguillarum M3]
MELTDYRRCITQPIQADNPVGERLIDDPLFDFVEDQMMKVGSLSHASVQWDEVEHSTLKLLSGKSKDLKL
LIYLLQCLHNQVTPLRFTTSLQLLSDFMSLYWEDCFPAPGKRGSLPRRKFFSQIVQRLALVIDKLDFAQF
DGPDRDELNTAIDALQQATTQAGLMSESVESLVAKVQAQLRRATEREQATQHVQETPAVERKTTTQSAIS
VDSSSDKATKQTLLKVAEFLSEQEFGIALAIRVRRFAVWSSITSLPEHDVSGETLLRAMAQERIKEYHDQ
MRSPDLALWRKVEQSLTMAPYWFEGQMMSYQIAQSLGQKAWSEAILSESQQFVARLPALLELKFKGGEPF
VNASVKEWLLSQQQSSAQGQVAGDWQDKRKEAFSLAKEGGIAVALSMLNDGLVSASEPRDKFYWRLLSAD
LLNSNNLDAMAKEQYQTLHAQVSTMSVTDWEPSLVEQLEQYTTSE
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|537456627|ref|NC_022224.1|:625116-626513 Listonella anguillarum M3 chromosome 2, complete sequence
ATGGAGTTAACCGATTATCGCCGCTGTATTACTCAGCCTATTCAAGCCGATAACCCTGTAGGTGAGCGCC
TGATTGATGATCCACTGTTTGATTTTGTTGAAGATCAAATGATGAAAGTGGGGTCACTCTCCCACGCTAG
CGTGCAATGGGATGAAGTCGAACACAGTACGCTCAAACTGCTCAGCGGAAAAAGTAAAGATCTCAAATTA
TTGATCTACTTGTTGCAGTGTTTGCATAACCAAGTCACACCGCTACGTTTCACCACGTCGCTGCAGCTGC
TGAGCGATTTCATGTCCCTTTACTGGGAAGATTGCTTCCCTGCGCCAGGCAAAAGAGGCAGTTTGCCACG
TCGCAAATTCTTCAGCCAGATTGTGCAGCGGTTAGCCTTGGTCATCGACAAGTTAGATTTCGCACAATTT
GATGGACCAGATCGTGATGAGTTAAACACCGCGATCGACGCGCTACAGCAAGCGACTACTCAAGCCGGAC
TGATGTCTGAAAGCGTTGAAAGTCTAGTAGCTAAAGTTCAAGCCCAACTGCGCCGCGCAACAGAACGTGA
GCAAGCGACTCAACATGTGCAAGAGACTCCGGCGGTTGAACGTAAAACCACCACCCAGAGCGCCATCTCA
GTCGACAGTTCAAGTGACAAAGCCACTAAGCAGACCTTACTAAAGGTAGCTGAGTTTTTGTCTGAACAAG
AGTTCGGCATTGCCTTGGCAATACGAGTCAGGCGTTTTGCCGTGTGGTCAAGTATTACCTCATTACCTGA
GCACGACGTCAGCGGTGAAACACTGTTACGGGCGATGGCGCAAGAACGAATCAAAGAGTATCACGACCAA
ATGCGTAGCCCAGATTTAGCCTTATGGCGCAAGGTAGAGCAGAGTTTGACCATGGCACCTTACTGGTTTG
AAGGGCAGATGATGAGCTATCAAATCGCGCAAAGCTTAGGCCAAAAGGCGTGGAGTGAAGCCATTTTGAG
TGAAAGCCAGCAGTTTGTGGCACGTCTACCTGCGCTGCTCGAGTTGAAATTCAAAGGAGGCGAGCCTTTT
GTCAATGCGAGCGTAAAAGAGTGGCTACTCAGCCAGCAGCAAAGTAGTGCCCAAGGCCAAGTAGCAGGTG
ATTGGCAAGACAAACGCAAAGAGGCGTTTAGCTTAGCGAAAGAGGGAGGCATTGCGGTGGCGCTCTCTAT
GCTCAACGATGGTCTGGTCAGCGCCAGTGAGCCAAGGGATAAATTCTATTGGCGGTTATTATCGGCTGAT
TTGTTAAATAGCAATAATTTAGATGCGATGGCGAAAGAACAGTACCAAACGTTACATGCTCAGGTTAGCA
CCATGAGCGTTACCGATTGGGAACCCTCATTAGTTGAGCAATTAGAACAATACACAACGTCAGAGTAA
 Primer design