SecReT6
Protein ID: 537457126
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17405
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]626531..630076 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDT1Y449
KEGG IDlag:N175_17405
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.00E-93, Aligned region: 510..824
ImcF-related_N [PF14331], Evalue: 6.10E-81, Aligned region: 89..129
ImcF-related_N [PF14331], Evalue: 6.10E-81, Aligned region: 199..455
DUF1215 [PF06744], Evalue: 1.50E-36, Aligned region: 848..878
DUF1215 [PF06744], Evalue: 1.50E-36, Aligned region: 919..1039
Protein Sequence: 1181 a.a.     [Download]
>gi|537457126|ref|YP_008489788.1| type VI secretion protein IcmF [Listonella anguillarum M3]
MWKFIVGIARKLTPGIAAAMPILLFSTFILLNVAIWWAGPWLEIAGNKPLESITARAVASSLFTLGALAV
WGVWQWRKLQGFKAEQKREDQLRQDPIKAYEERQEVELNQVMVSMKENLNKRNYLYALPWYLVLGLENAG
KTSLINRSGQNFVFSSVMRASGQKSENPYSFDWWIGDESVLIDPDGELLTQGNHSNDNDGAMERRLWLHF
VNWLERTRSRRPLNGIVLALDVSHLATATATERKAYANLLRARLRELMETLSTRLPVYIALTKLDLLHGF
EPFFKHYSRSQREDVLGFTFSLDSIDDLDNWLNEFSKDYSQFVERINDVLPHAVSVPMDLEERNAIYSFT
RQISGLKEILLQFFNDALASDQFSTSALVRGAYFTSVYQQGVPTNAFDDAASRRYGLDHAINKAQQAKNS
TVYFTQKLFNNIIYPEAGLASDNFRVAKQKRRLIGLSVVAGSIATVLLVGTWHRYYLSNVKHSDAVLAKV
NEYKNEFPSNLYLASQQDVLVPLNKIREATLEFGFFRDKPQYISDFGLYQGHTIGPMVEATYLNLLENRF
LPLLMADVVVQLNQAKTDEEKLAVLRVYRMMVDKSGRYKDYVLDYFSKYWQQEFAGQRVIQEELLGHLDY
AMLHTDLAGDRARGDRNAESVMKPYDQVVAKVQSDLGSMPNDQRVYRNLKLNAQTVLGPSINLRNLIGPV
FDVVFEERVVNSSSLYIPQMLTKKGFEDYFMPQSESVSELALIDSWVLGQSKSAQFSEADKHDLRNKIRS
LYVADYTNTWRAALNEISVKYFSDINDAVSVLENFTGNIEPMQRLLRTLESNTQMYASVPKDEAAQKELL
KNPKYKVASQIDAPFAELNAMLKPVGDKPAYINEVLVAVEELQNYLKSIQEAPDVGMAALDATKARVKLV
NADPIYTVKRIASGLPKPLDTMVSKLADESWYVVKQEAIKHLEVRWHDDVYKTFEEKLAGRYPFNESSNK
DSSLSDFEAFFAPNGTLDNFYNNQLRMFVEENIAVNDDDNAQSIIRKDVLEQLKQAKKIQQAFFNRKGVL
DVSFSVEPLRLSNNKRRSVLNVDGQYLAYSHGPRDSVELIWPNTLRDSAISKVTLVPTKNNMSPRSINIQ
GPWAFFRLLEQGDVVGASSTSVDFKFAVDGGEMIYRLNSEADINPFTERLFKSFKLSKTLY
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|537456627|ref|NC_022224.1|:626531-630076 Listonella anguillarum M3 chromosome 2, complete sequence
ATGTGGAAATTTATTGTTGGGATCGCAAGAAAGTTAACACCGGGCATTGCCGCGGCGATGCCTATTTTGC
TATTTAGCACATTCATTCTATTGAATGTTGCGATTTGGTGGGCAGGCCCTTGGCTAGAGATCGCGGGTAA
TAAGCCACTTGAATCGATAACCGCTCGCGCAGTGGCAAGTAGCTTGTTCACTTTAGGTGCCTTGGCCGTT
TGGGGCGTGTGGCAGTGGCGAAAATTGCAAGGTTTTAAAGCCGAGCAAAAGCGTGAAGATCAGCTTCGCC
AAGATCCAATTAAAGCCTATGAAGAGCGCCAAGAGGTTGAGCTGAACCAAGTGATGGTCAGCATGAAAGA
GAACCTCAATAAACGTAATTATCTCTATGCGTTGCCATGGTATTTAGTGCTCGGTTTGGAAAATGCCGGT
AAAACCAGCCTCATCAACCGCTCTGGGCAAAACTTTGTTTTTTCTTCGGTAATGCGAGCCTCGGGTCAAA
AAAGTGAAAACCCGTATTCGTTTGATTGGTGGATTGGCGATGAATCGGTATTGATCGATCCAGATGGAGA
GCTACTGACACAAGGTAACCACAGCAATGATAACGATGGTGCGATGGAGCGCCGTTTGTGGCTTCATTTT
GTTAATTGGTTGGAGAGAACGCGTAGCCGTCGTCCACTCAACGGTATCGTTTTAGCGTTAGACGTTTCTC
ACTTAGCAACCGCAACTGCAACCGAGCGTAAAGCTTACGCCAATTTATTGCGTGCTCGTTTACGTGAATT
GATGGAGACGTTATCCACGCGTCTACCCGTCTATATTGCATTGACGAAATTGGATTTATTACACGGTTTT
GAACCTTTCTTTAAACATTACTCGCGCAGTCAGCGTGAAGATGTGCTGGGCTTTACCTTTTCGCTCGACT
CTATTGATGACTTGGATAACTGGCTCAACGAGTTTTCAAAAGACTACAGTCAGTTTGTTGAGCGCATTAA
TGATGTACTGCCGCATGCGGTTTCTGTACCTATGGATCTCGAAGAGCGCAATGCTATTTATAGTTTCACG
CGTCAAATTTCTGGTTTAAAAGAGATCTTATTACAATTTTTCAACGATGCATTGGCCAGTGATCAGTTCT
CTACGTCGGCTTTGGTGCGTGGTGCGTATTTCACTTCTGTGTATCAACAGGGCGTACCCACAAACGCATT
TGATGATGCCGCTTCACGTCGTTACGGGCTAGATCATGCGATCAACAAAGCGCAGCAAGCCAAAAACTCA
ACGGTTTATTTCACACAAAAACTGTTTAATAACATCATTTATCCTGAAGCTGGGCTTGCCTCAGATAATT
TTCGTGTTGCGAAGCAAAAACGGCGCTTGATTGGTTTGTCAGTAGTGGCCGGCTCTATTGCAACTGTGTT
ATTAGTTGGCACTTGGCATCGTTATTACCTTAGTAACGTGAAGCACTCTGATGCTGTGTTAGCGAAAGTA
AACGAGTACAAAAACGAGTTCCCCTCTAATCTTTATTTAGCCTCTCAGCAAGATGTTCTCGTGCCGCTCA
ATAAAATTCGAGAGGCGACATTGGAGTTTGGCTTCTTCCGTGATAAACCACAGTACATTTCCGATTTTGG
TTTGTACCAAGGCCACACGATTGGTCCAATGGTTGAAGCGACCTATTTGAATCTATTGGAAAACCGCTTT
TTACCTCTGCTAATGGCTGATGTCGTTGTGCAGCTTAACCAAGCCAAAACAGATGAAGAGAAACTGGCCG
TGCTGCGTGTTTATCGCATGATGGTAGATAAAAGCGGCCGCTATAAGGATTATGTACTCGATTATTTCTC
CAAATACTGGCAGCAAGAGTTCGCTGGGCAACGCGTGATCCAAGAAGAACTACTGGGGCATTTAGACTAC
GCCATGTTACACACGGATTTAGCGGGTGATCGCGCGCGCGGTGATCGCAATGCAGAGTCGGTGATGAAGC
CTTATGATCAGGTGGTGGCGAAAGTGCAGTCTGATCTTGGTTCTATGCCTAACGATCAACGTGTTTACCG
TAATTTGAAGTTGAATGCACAAACGGTTCTTGGCCCCTCGATCAATTTACGCAACTTGATTGGCCCCGTC
TTTGATGTGGTTTTTGAAGAGCGAGTGGTCAACAGCAGCTCGCTGTATATTCCGCAAATGCTTACCAAAA
AAGGGTTTGAAGATTACTTCATGCCGCAATCAGAATCCGTTTCTGAGCTGGCCTTGATCGACAGTTGGGT
ACTAGGGCAATCCAAATCGGCTCAATTTAGCGAAGCGGATAAGCATGACCTTCGTAACAAAATCCGCAGC
TTGTATGTGGCGGACTACACCAATACCTGGCGTGCGGCTCTTAATGAAATCAGCGTTAAGTATTTTAGCG
ACATCAATGACGCGGTGTCAGTATTAGAAAACTTTACTGGCAACATTGAACCGATGCAGCGTTTGCTTCG
CACTTTAGAAAGCAATACTCAAATGTATGCCAGCGTGCCTAAAGATGAAGCCGCGCAAAAAGAGCTGTTA
AAAAATCCAAAATACAAAGTTGCTTCGCAGATTGATGCGCCCTTTGCTGAACTAAACGCTATGCTCAAGC
CAGTCGGTGATAAGCCAGCGTACATCAATGAAGTGTTAGTGGCGGTGGAAGAGTTACAAAATTACCTCAA
ATCTATTCAAGAAGCGCCAGATGTTGGTATGGCTGCGCTTGATGCCACTAAAGCACGCGTAAAATTAGTG
AACGCTGATCCAATTTACACGGTGAAACGTATTGCATCAGGTTTGCCTAAACCGCTCGATACTATGGTGT
CTAAACTGGCGGATGAGAGTTGGTATGTTGTCAAACAAGAAGCGATTAAGCACCTTGAAGTTCGTTGGCA
TGATGATGTTTACAAAACCTTTGAAGAGAAATTAGCTGGGCGCTATCCATTTAATGAGTCATCCAACAAA
GACAGTTCTCTTTCTGACTTTGAAGCGTTTTTTGCGCCCAACGGCACATTAGACAACTTCTACAACAACC
AGCTAAGAATGTTTGTGGAAGAAAATATTGCGGTCAATGATGACGATAACGCGCAGTCGATTATTCGCAA
AGACGTTCTAGAACAGCTCAAGCAGGCGAAGAAAATTCAGCAAGCTTTCTTTAACCGCAAAGGGGTCTTA
GACGTTAGTTTCTCGGTTGAACCACTACGCTTGAGCAACAACAAACGCCGTAGTGTGTTAAATGTTGACG
GTCAATATCTCGCTTATAGTCACGGCCCAAGAGACAGTGTCGAGTTGATTTGGCCAAATACGCTGCGTGA
TTCTGCGATCTCTAAAGTAACGTTAGTGCCGACTAAAAATAATATGTCGCCACGAAGTATTAATATCCAA
GGTCCGTGGGCATTTTTCCGCTTGCTTGAACAAGGTGATGTAGTGGGTGCTAGTTCCACGTCGGTTGACT
TTAAGTTTGCAGTTGACGGTGGTGAGATGATTTATCGACTCAATTCAGAGGCGGATATCAACCCATTCAC
CGAGCGGTTATTTAAGTCATTCAAACTCTCGAAAACCCTTTACTAA
 Primer design