SecReT6
Protein ID: 537457127
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17410
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]630134..631429 [+]
Producttype VI secretion protein
NoteTssA
UniProt IDT1Y326
KEGG IDlag:N175_17410
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.70E-09, Aligned region: 46..95
ImpA-rel_N [PF06812], Evalue: 8.70E-09, Aligned region: 322..336
Protein Sequence: 431 a.a.     [Download]
>gi|537457127|ref|YP_008489789.1| type VI secretion protein [Listonella anguillarum M3]
MSNIVFIDHARFHLIDDAAAVRHIDAYQKVRDEINRRNNPLSGGPDWAVVKVACETLAKGPGIDLLLCGY
YTVACLKMQGLAGYANGVELLCCCLSNLPKPDVKSAKMRKEVLDWVNARVVRELKDLRPNHEALRDLYRC
ERFCERMHAILELQQPDYLVDFEGVGFAIFEHIDRLETQYHSLLKRHTQTEQVELVRNQKRSRVTHVAAF
ISGVLGVVMVYGAVTYLPFFNSMSYATNLRLPALHTPEQVNAFQQANSPAKLEQLSNEIVPLYREAIEQK
MARSFESARVEAQQVLDALLQLYPQTESVLEVDQAFADAKREALQQTERFMERFSETRTKMANIALLAQK
GKLTELQRQTKSLEEFAISLSPIYGRAAYVEELLKKGDVVQAEQEFMILKQRLNNLSWKMAELDKQFEHL
TVTHNQEAQAQ
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|537456627|ref|NC_022224.1|:630134-631429 Listonella anguillarum M3 chromosome 2, complete sequence
ATGTCCAATATTGTATTTATCGACCACGCTCGTTTTCATTTGATAGATGATGCTGCCGCTGTTCGTCACA
TTGATGCCTACCAAAAGGTGAGAGATGAGATCAATCGTCGTAACAACCCATTATCAGGTGGTCCAGACTG
GGCTGTGGTGAAAGTTGCTTGTGAAACATTAGCAAAAGGCCCGGGGATTGACCTTTTGCTGTGCGGTTAT
TACACCGTAGCCTGTTTAAAAATGCAGGGCTTAGCGGGATACGCCAATGGTGTTGAACTGCTGTGCTGCT
GCTTAAGTAATTTGCCAAAACCGGACGTAAAATCGGCGAAAATGCGCAAGGAAGTGCTCGATTGGGTTAA
TGCTCGTGTAGTGCGGGAGTTAAAAGATCTGCGTCCGAATCATGAAGCACTGCGTGATTTATACCGTTGT
GAGCGCTTTTGTGAGCGCATGCATGCCATTTTAGAGCTGCAACAGCCCGACTATTTGGTTGATTTCGAAG
GAGTAGGTTTTGCTATTTTTGAACATATTGATCGTTTAGAAACACAATATCATTCGCTGCTAAAGCGCCA
TACTCAAACGGAACAGGTTGAGCTGGTGCGTAATCAAAAGCGCTCACGTGTTACGCATGTGGCCGCTTTT
ATATCCGGTGTTCTTGGTGTTGTGATGGTGTATGGGGCCGTCACTTATTTGCCGTTTTTCAACTCAATGT
CTTATGCAACCAACCTAAGGTTACCTGCTTTACATACGCCAGAGCAGGTCAATGCGTTTCAACAGGCTAA
CTCGCCAGCCAAGCTTGAACAGTTGTCAAATGAGATTGTGCCATTGTACCGAGAGGCGATTGAGCAAAAA
ATGGCGCGCTCTTTTGAATCGGCTCGTGTTGAAGCCCAGCAAGTGTTGGATGCGTTATTGCAACTTTATC
CCCAAACCGAATCGGTGCTGGAGGTTGATCAAGCGTTTGCCGATGCTAAGCGTGAAGCTCTGCAACAAAC
TGAGCGCTTTATGGAGCGTTTTAGTGAAACGCGAACCAAGATGGCTAACATCGCGCTGCTCGCGCAAAAA
GGAAAATTAACCGAACTGCAAAGACAAACCAAATCGCTGGAGGAGTTCGCTATTAGTTTGTCTCCTATTT
ACGGGAGAGCTGCATATGTCGAAGAGTTGCTCAAAAAAGGTGATGTTGTACAGGCTGAACAGGAGTTTAT
GATTCTGAAGCAGCGGCTTAATAATTTGAGCTGGAAAATGGCCGAGCTCGACAAGCAGTTTGAGCATTTG
ACTGTGACACATAATCAGGAAGCTCAGGCTCAATAA
 Primer design