SecReT6
Protein ID: 537457128
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17415
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]631561..633645 [+]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDT1Y3Q5
KEGG IDlag:N175_17415
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.70E-68, Aligned region: 53..347
Phage_base_V [PF04717], Evalue: 3.40E-23, Aligned region: 386..479
DUF2345 [PF10106], Evalue: 0.00045, Aligned region: 508..632
Protein Sequence: 694 a.a.     [Download]
>gi|537457128|ref|YP_008489790.1| type IV secretion protein Rhs [Listonella anguillarum M3]
MLFCDKRVEGKKMARLSFRLTVEGLADDTLVVHEYQGVESLSDSTQAGLRCYGFRYEIKLASRQSGLTAL
ELVDKTAQLEILRDDLVVQRVHGIVRQFSKGDIGHHHTFYSLTLVPALERLSLRQNSRIFQLKTVPEILS
IVLQEMGINDYAFSLKRECAQREFCVQYRETDIDFLHRLAAEEGLVYHFIHEEGKHTLFFSDDSQSLTKR
ETPIPYNVLAGGVMESPYVSQLTQHSQTEVSHSALQDYSFKKPSYSFAQQAQGREMDYQQATYEHFDAPG
RFKDDISGKAFNQIRLEYLRREARTATGKSNHPGLQAGTKFDLQEHLDDSANRDWVVVQVHHQGQQPQAL
EEEGGSGATTYSNQFTLIPADVTWRATPQAKPQVDGPCMALVVGPDGEEIFCDEHGRVKLHFPWDRYSNG
DEHSSCWVRVSQGWAGSQYGMIAIPRIGHEVIVSFLNGDPDQPIVTGRTYHATNKAPYALPDNKTKTVLR
SETHQGEGFNELSFEDQAAQEKIYLHAQKDLDALVLNDATAHIKHDQHLTVDNDQFTHVKHNQHLTVEGE
SRESVKGSCILMVDGSLHVKSGQVWTNESGDEIHIKAGQKVVIEAGSEITVTAGGSFVKVDPAGVHLSGA
GVNLNSGGSAGSGSGFSGDLPLLPGELELQKSPAPPQTILYQALLQAEEARVPAVKVCPLAGDA
 
Nucleotide Sequence: 2085 bp     [Download]
>gi|537456627|ref|NC_022224.1|:631561-633645 Listonella anguillarum M3 chromosome 2, complete sequence
GTGTTATTTTGCGATAAAAGAGTGGAAGGGAAAAAGATGGCAAGGTTAAGTTTTAGGCTCACCGTGGAGG
GTTTGGCAGACGACACGTTAGTGGTGCATGAATACCAAGGTGTGGAATCGCTGTCTGATAGCACGCAAGC
GGGCCTGCGCTGCTACGGTTTTCGCTATGAGATAAAACTGGCCAGTCGTCAATCTGGCTTAACGGCACTG
GAGCTGGTGGACAAAACCGCTCAGCTTGAGATACTGCGTGATGACCTTGTCGTGCAGCGCGTGCACGGCA
TTGTGCGCCAGTTCAGTAAAGGCGATATTGGCCATCATCACACCTTTTACTCACTGACCTTAGTCCCGGC
ATTAGAGCGGTTATCACTGCGCCAAAACAGCCGCATCTTCCAGCTCAAAACCGTTCCCGAAATCCTCTCC
ATCGTACTGCAAGAAATGGGCATTAACGACTACGCCTTCTCGCTGAAGCGCGAGTGTGCACAGCGTGAAT
TCTGCGTGCAGTACCGTGAGACGGATATCGACTTCTTGCACCGCTTAGCCGCCGAAGAAGGCTTGGTGTA
TCACTTCATTCATGAAGAGGGGAAACACACCCTCTTTTTCAGTGACGACAGCCAAAGCCTGACGAAGCGA
GAAACGCCTATCCCTTACAACGTCCTTGCGGGTGGCGTGATGGAGAGCCCTTATGTGTCGCAATTAACGC
AACACAGCCAAACCGAAGTGAGCCACAGCGCGCTGCAAGATTACAGCTTTAAAAAGCCGAGCTACTCGTT
TGCCCAGCAAGCGCAAGGGCGCGAAATGGATTACCAGCAAGCGACCTACGAGCACTTTGATGCACCGGGT
CGCTTTAAAGACGACATCAGCGGCAAAGCCTTTAATCAAATTCGCTTAGAGTACTTACGACGAGAAGCGC
GTACCGCGACCGGAAAAAGTAACCATCCGGGCCTGCAAGCGGGCACAAAGTTCGACTTACAAGAGCATCT
TGACGACAGCGCGAACCGCGATTGGGTTGTCGTGCAAGTGCATCATCAGGGGCAGCAGCCACAAGCATTG
GAAGAAGAGGGCGGCAGTGGCGCGACCACGTACAGCAACCAATTCACGCTCATTCCTGCTGATGTCACGT
GGCGTGCGACACCGCAAGCCAAACCTCAAGTGGATGGCCCTTGCATGGCATTGGTGGTGGGGCCTGATGG
CGAAGAAATCTTCTGTGACGAACATGGCCGCGTCAAACTGCATTTCCCGTGGGACAGATATTCCAACGGC
GATGAACACAGCTCATGCTGGGTGCGCGTCTCACAAGGTTGGGCTGGCAGCCAATATGGCATGATAGCCA
TTCCGCGCATTGGTCATGAAGTCATCGTCTCGTTTCTTAACGGCGACCCAGACCAACCGATAGTGACAGG
CCGTACCTACCATGCGACCAATAAAGCGCCGTACGCACTGCCGGATAACAAAACCAAAACCGTGCTGCGC
AGTGAAACGCACCAAGGAGAAGGGTTTAACGAGCTGAGTTTTGAAGACCAAGCAGCGCAAGAGAAAATCT
ACCTACACGCGCAAAAAGACTTAGACGCCTTGGTGCTCAATGACGCCACGGCGCACATCAAGCACGACCA
GCACCTCACGGTGGATAACGACCAATTCACGCACGTTAAACATAACCAGCACCTCACGGTGGAGGGCGAA
AGCCGCGAATCGGTTAAGGGTAGCTGTATATTAATGGTCGATGGTTCCTTGCACGTAAAATCAGGGCAAG
TTTGGACTAATGAAAGTGGAGATGAAATCCACATCAAAGCTGGACAAAAAGTGGTGATTGAAGCAGGGTC
AGAAATTACCGTGACAGCCGGTGGCAGTTTTGTCAAAGTCGATCCTGCTGGTGTCCATCTTTCTGGGGCG
GGCGTTAATTTAAACTCAGGCGGAAGTGCGGGCAGTGGCAGTGGTTTTAGTGGCGATTTACCGTTATTAC
CTGGTGAGCTTGAACTGCAAAAATCCCCCGCGCCACCTCAAACCATTCTTTACCAAGCGCTATTGCAAGC
TGAAGAAGCACGAGTGCCAGCCGTAAAAGTATGCCCATTAGCCGGGGATGCCTAA
 Primer design