SecReT6
Protein ID: 537457464
SecReT6 ID844
T6SS typei1
Gene symbol-
Locus tagN175_17360
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]615186..616169 [+]
Producthypothetical protein
NoteTssG
UniProt IDT1Y5P9
KEGG IDlag:N175_17360
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.40E-90, Aligned region: 16..314
Protein Sequence: 327 a.a.     [Download]
>gi|537457464|ref|YP_008489779.1| hypothetical protein N175_17360 [Listonella anguillarum M3]
MAAAAVPEPLLGLPSDVRTYNFYQLVELLQKLNAFNPESEDWERTCQLVFSANPSLGFAPADVTDLREFA
DERLILQTNFFGLTGAQSPLPGFILQQLVEEDPGGFKRPFLDFFNNRLINLVYRVWRKYRYYVRFQAGAQ
DQFSSQLFALVGLGDADLRGETPINWCKMLAYAGTLAGRSRSPQVVSGIIAHCFDLQEVSIRQWVRRKVR
IEPYQQFCLGKQNGELGINSMLGESVMDCNGKFVICIKNLTRERFADFLPSGKEHQPLCKLVEFILREQM
AYDLELTMHESEAPVMSLCHDSGVALGWSSFLGRDLADKSVLIQVRQ
 
Nucleotide Sequence: 984 bp     [Download]
>gi|537456627|ref|NC_022224.1|:615186-616169 Listonella anguillarum M3 chromosome 2, complete sequence
ATGGCTGCGGCGGCTGTGCCGGAGCCTCTACTGGGTTTACCAAGCGATGTACGAACGTACAACTTCTACC
AGTTGGTGGAACTGCTGCAAAAACTTAATGCGTTTAATCCTGAATCAGAAGATTGGGAACGGACATGCCA
GTTGGTATTCAGTGCCAACCCAAGTTTAGGCTTTGCACCAGCAGACGTAACGGATTTACGTGAGTTCGCG
GATGAGCGCCTGATCTTACAAACCAATTTTTTTGGATTAACTGGGGCACAGTCACCGTTGCCTGGTTTTA
TTTTGCAGCAATTGGTCGAAGAAGATCCCGGTGGTTTCAAGCGGCCCTTTTTAGATTTTTTCAATAACCG
GTTGATTAACCTTGTGTATCGCGTATGGCGAAAGTATCGCTATTACGTCCGTTTTCAAGCGGGTGCGCAG
GATCAATTTTCATCACAGCTGTTCGCTTTAGTCGGTTTGGGTGATGCGGACTTGCGCGGCGAAACACCGA
TAAATTGGTGCAAGATGCTGGCTTATGCGGGCACTTTGGCTGGCCGAAGTCGTTCACCGCAAGTGGTGTC
TGGCATCATCGCGCACTGTTTTGATCTGCAAGAAGTCAGTATTCGCCAGTGGGTTCGACGCAAAGTCCGG
ATAGAGCCTTATCAGCAGTTTTGCTTAGGTAAGCAGAATGGTGAGCTTGGGATCAACAGCATGTTGGGTG
AGTCAGTGATGGACTGTAACGGTAAGTTTGTTATCTGTATCAAAAACTTAACTCGAGAACGATTTGCCGA
TTTTTTGCCATCAGGCAAAGAACATCAACCGCTGTGTAAGTTGGTGGAGTTTATTTTACGAGAGCAGATG
GCTTACGACCTTGAGCTGACCATGCACGAGAGCGAGGCTCCGGTGATGAGTTTATGCCATGACAGTGGTG
TAGCTTTGGGTTGGTCATCATTTTTAGGGCGCGATTTGGCGGACAAAAGCGTGCTTATACAAGTAAGGCA
ATAG
 Primer design