SecReT6
Protein ID: 538392478
SecReT6 ID845
T6SS typei3
Gene symbolicmF1
Locus tagVAPA_1c02480
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]261177..264812 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDT1X441
KEGG IDvpd:VAPA_1c02480
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.30E-98, Aligned region: 207..471
ImcF-related_N [PF14331], Evalue: 7.30E-98, Aligned region: 836..866
IcmF-related [PF06761], Evalue: 1.50E-88, Aligned region: 526..836
IcmF-related [PF06761], Evalue: 1.50E-88, Aligned region: 908..954
DUF1215 [PF06744], Evalue: 3.80E-35, Aligned region: 945..1068
Protein Sequence: 1211 a.a.     [Download]
>gi|538392478|ref|YP_008514051.1| type VI secretion protein IcmF [Variovorax paradoxus B4]
MLRAIFRFLVSRDLWVFFGLLAVAFLIWIIGPVIAVGRYRPFESEFVRIVVIALMFAIWIARVLYRKWRE
RRLNAQLLNQLRTPSPKEKAAKPEDAPEIKELQSGFTDATAILKNMRFGADADGKAAGRFAVFDRQYLYQ
LPWYIFIGAPGSGKTTALVNSDLDFPLADQLGKAAVRGIGGTRNCDWWFTNEAVLIDTAGRYTTHESNRE
TDEGEWKGFLDLLKKFRPRQPINGAILTISIADLPLADDAQRARHAMALRKRLLELRNGLGINFPVYVLV
TKTDLLAGFNEYFGSLGRAERSQVWGFTFPIDANPADPAKADLRERFHQEYKLLHQRLDERLPELLAAEP
DQLRRAQAYLLPQQFASFEDILGTFLADVFNPSKFEVAPMLRGVYFTSGTQEGTAFDRVMGAIKRYLQVN
APPAPPPGPGKSYFLKELLQQVIFRDAGVAGTNLRWYRRKRAIDLTGYGLIGVLLVVVLGACVNSWRNNR
DYVAEVDNNAKAFNKAAARGELPTVVDSNSDIASSLPVLDRLRDLPKSGQFDIGDPPVSYRFGLYQGEKL
QAATDGVYQRALESVLLPQASQRVEQALREASKTDAEYSYEALKAYLMLYDAERYDADFLQAWLLTDVDR
KIGAGLTREQRTNLESHLRALFAERVVTSPFAKDDRLVTETRARLAGVPLAQRSYARLRRILLQTSPPNA
FSIAEAAGAESALVIKRASGKPLTDGIPTLFTYRGYWDIFDKRMAETTLALEQEDRWVLQIRAPGMTDIT
SRELLLREVRRLYLTDYIRVWDDYLADVRLADSRSLLQSIQMTRVLSTSESPMSRLIRGAARETDLLRNH
DEATRSLLDQAQNRVASTRERIEQLIGQPDGSQRRNTVPDRPESLVDNHFAPLRRMVTAPKAGGQAPIDA
TAALINELYTFLTATDTALRSGNIPPSSDAVTKVQAEAGRLPVPFQGMLNDLSATASSKAAAVTRQNIGQ
NAAATIGQFCGQAIAGRYPFSRGSNRDVAAGDFAQLFAPGGMMDDFFQKNLASQVDTSVNPWAFKKGVDG
SSPGRSAYLDSFQKAQAIRDVFFSGMAGGRTPSFTIDIRPEDMDAAISQFTLDIDGQTVRYAHGPQAPST
VKWPGPRNSNQVRLQVTTASGTPAGGIVTEGPWALHRLFDKASISSGSAPESFNATFDLQGKKVVLAVTA
NSVYNPLRLNQMNGFSCPGKS
 
Nucleotide Sequence: 3636 bp     [Download]
>gi|538392231|ref|NC_022247.1|:261177-264812 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGCTGCGCGCGATTTTCCGTTTCCTCGTGAGCCGCGACCTGTGGGTCTTTTTCGGGCTCCTGGCCGTTG
CGTTCCTGATCTGGATCATCGGCCCAGTCATCGCGGTGGGCCGCTACCGGCCGTTCGAAAGCGAGTTCGT
CCGCATCGTGGTCATCGCGCTGATGTTCGCGATCTGGATCGCACGGGTGCTCTATCGCAAATGGCGCGAG
CGGCGCCTCAATGCGCAGCTGCTCAACCAGCTGCGCACGCCGTCGCCCAAGGAGAAGGCCGCCAAGCCCG
AGGACGCCCCTGAGATCAAGGAGCTGCAAAGCGGCTTCACCGACGCGACGGCCATCCTGAAGAACATGCG
CTTCGGCGCGGACGCCGACGGCAAGGCCGCCGGGCGCTTCGCGGTGTTCGACCGCCAGTACCTGTACCAG
CTGCCCTGGTACATCTTCATCGGCGCGCCGGGCTCGGGCAAGACCACCGCGCTGGTCAACTCCGACCTCG
ACTTTCCTCTCGCCGACCAGCTCGGCAAGGCCGCGGTGCGCGGCATCGGCGGCACGCGCAACTGCGACTG
GTGGTTCACCAACGAGGCGGTGCTCATCGACACCGCCGGGCGCTACACCACGCACGAGAGCAACCGCGAA
ACCGACGAGGGCGAGTGGAAGGGCTTTCTCGACCTGCTCAAGAAGTTCAGGCCGCGCCAGCCGATCAACG
GCGCCATCCTCACCATCAGCATTGCCGACCTGCCGCTGGCCGACGACGCGCAGCGCGCGCGCCACGCCAT
GGCGCTGCGCAAGCGGCTGCTCGAACTGCGCAACGGACTGGGCATCAATTTTCCGGTGTACGTGCTGGTC
ACCAAGACTGACCTGCTGGCCGGCTTCAACGAGTATTTCGGCTCGCTGGGCCGGGCCGAGCGCTCGCAGG
TCTGGGGCTTCACGTTTCCGATCGACGCCAACCCGGCAGACCCCGCCAAGGCCGACCTGCGCGAGCGCTT
CCACCAGGAATACAAGCTGCTGCACCAGCGCCTGGACGAGCGCCTGCCGGAGCTGCTGGCGGCCGAGCCC
GACCAGCTGCGCCGCGCGCAGGCCTACCTGCTGCCCCAGCAGTTCGCGAGCTTCGAAGACATCCTCGGCA
CCTTCCTGGCCGACGTGTTCAACCCTTCGAAGTTCGAAGTCGCGCCGATGCTGCGCGGCGTGTACTTCAC
CAGCGGCACGCAGGAGGGCACGGCCTTCGACCGCGTGATGGGCGCGATCAAGCGCTACCTGCAGGTCAAT
GCGCCGCCCGCGCCGCCGCCGGGTCCGGGCAAGAGCTACTTCCTGAAGGAGCTGCTGCAGCAGGTGATCT
TCCGCGACGCGGGCGTGGCCGGCACCAACCTGCGCTGGTACCGGCGCAAGCGGGCCATCGACCTGACAGG
CTATGGCCTCATCGGCGTGCTGCTGGTGGTGGTGCTGGGCGCCTGCGTCAACAGCTGGCGCAACAACCGC
GACTACGTGGCCGAAGTCGACAACAACGCCAAGGCCTTCAACAAGGCCGCGGCGCGCGGCGAGCTGCCGA
CGGTGGTCGATTCGAACAGCGACATCGCCAGCTCGCTGCCGGTGCTCGACCGCCTGCGCGACCTGCCCAA
GTCAGGCCAGTTCGACATCGGCGATCCGCCCGTGAGCTACCGCTTCGGCCTCTATCAGGGCGAGAAGCTG
CAGGCCGCGACCGACGGCGTCTATCAGCGTGCGCTCGAAAGCGTGCTGCTTCCGCAGGCCTCGCAGCGCG
TGGAGCAGGCGCTGCGCGAGGCCTCCAAGACCGATGCCGAATACAGCTACGAGGCGCTCAAGGCCTACCT
CATGCTGTACGACGCGGAACGCTACGACGCCGACTTTCTCCAGGCCTGGCTGCTCACCGACGTGGACCGC
AAGATCGGCGCCGGGCTCACGCGCGAGCAGCGCACCAACCTCGAGTCGCACCTGCGGGCGCTGTTTGCGG
AACGCGTGGTGACCTCGCCCTTCGCCAAGGACGACCGGCTCGTCACCGAGACGCGAGCCCGCCTGGCCGG
CGTGCCGCTGGCGCAGCGCTCCTATGCGCGGCTGCGGCGCATCCTGCTGCAGACCAGCCCGCCCAACGCC
TTCAGCATTGCGGAGGCGGCAGGGGCCGAGTCCGCGCTGGTGATCAAGCGCGCGAGCGGCAAGCCGCTCA
CCGACGGCATCCCGACGCTGTTCACCTACCGCGGCTACTGGGACATCTTCGACAAGCGCATGGCGGAGAC
CACGCTCGCGCTCGAACAGGAAGACCGCTGGGTGCTGCAGATCCGCGCGCCGGGCATGACCGACATCACC
TCGCGCGAGCTGCTGCTGCGCGAAGTGCGTCGGCTCTATCTCACCGACTACATCCGCGTCTGGGACGACT
ACCTGGCCGACGTCCGGCTGGCCGACAGCCGCTCGCTGCTGCAGAGCATCCAGATGACGCGCGTGCTCTC
GACCAGCGAGTCGCCGATGTCGCGCCTCATCCGCGGTGCGGCGCGCGAGACCGACCTGCTGCGCAACCAC
GACGAGGCCACGCGCAGCCTGCTCGACCAGGCGCAGAACCGCGTGGCCAGCACGCGCGAACGCATCGAGC
AGCTCATCGGGCAGCCCGACGGCAGCCAGCGCCGCAACACCGTGCCGGACCGCCCCGAATCGCTGGTGGA
CAACCACTTCGCGCCGCTTCGCCGCATGGTCACCGCGCCCAAGGCCGGCGGCCAGGCGCCGATCGACGCC
ACCGCCGCGCTCATCAACGAGCTCTACACCTTCCTCACCGCCACCGACACCGCCTTGCGCAGCGGCAACA
TCCCGCCGTCGAGCGATGCGGTCACCAAGGTGCAGGCCGAGGCGGGTCGCCTGCCGGTGCCGTTCCAGGG
CATGCTGAACGATCTCTCGGCCACCGCGTCGTCCAAGGCGGCGGCGGTGACGCGGCAGAACATCGGGCAG
AACGCGGCCGCCACCATCGGCCAGTTCTGCGGCCAGGCCATTGCGGGGCGCTATCCGTTCTCGCGCGGCT
CGAACCGCGACGTGGCCGCCGGCGACTTCGCGCAGCTGTTCGCGCCGGGCGGCATGATGGACGACTTCTT
CCAGAAGAACCTGGCCTCTCAGGTCGACACCTCCGTCAACCCGTGGGCCTTCAAGAAGGGGGTGGACGGC
AGCTCGCCGGGGCGCTCGGCGTATCTCGATTCGTTCCAGAAGGCGCAGGCGATCCGCGACGTGTTCTTCT
CGGGCATGGCGGGCGGGCGCACGCCCTCGTTCACCATCGACATCCGGCCCGAGGACATGGACGCCGCCAT
CAGCCAGTTCACGCTCGACATCGACGGCCAGACGGTGCGCTATGCGCACGGCCCGCAGGCGCCCAGCACC
GTCAAGTGGCCCGGCCCGCGCAACAGCAACCAGGTGCGGCTGCAGGTGACGACTGCCAGCGGCACGCCGG
CCGGCGGCATCGTCACCGAAGGGCCGTGGGCGCTGCACCGGCTCTTCGACAAGGCCTCGATCTCGTCGGG
CAGCGCACCCGAATCGTTCAACGCGACCTTCGACCTGCAAGGCAAGAAGGTGGTGCTGGCGGTGACAGCG
AACAGTGTCTACAACCCGCTGCGGCTGAACCAGATGAACGGCTTTTCATGCCCGGGGAAATCCTAG
 Primer design