SecReT6
Protein ID: 538392822
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c05920
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]646308..647639 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDT1X495
KEGG IDvpd:VAPA_1c05920
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.50E-149, Aligned region: 19..442
Protein Sequence: 443 a.a.     [Download]
>gi|538392822|ref|YP_008514395.1| type VI secretion protein [Variovorax paradoxus B4]
MSWRTKVVWSEGMLLQPQHLQQSERHADHARHVLLRSTTPYAWGFAEIEIDQAALTLGKLALVRAVGIFG
DGTVFDMPAVDPLPEPIDIPPAMRDEAVMLALPLRRAGAREADAEDYEELVRHRVLESEVPDSNTAGERT
AVLQLGQLHTRLMRASEATDAWTTLGVARVVERRVDNQVQLERAMLPPLLDVAGHGVIRSWLDELLGLLR
QRGEALAGRMTQGGTGGVAEIADFMLLQTVNRNEAVFAHLARSAMLHPQRFFELALGLAGDLASFRDSRR
VARFGPYIHDDLALSFRPLMDDLRRSLSMVLEQSAIRIDLHDRKHGVRVAMVTDVELQRKATFVLAVNAN
MPSEALRARFPTQVKIGPVERIRDLVNLALPGVTLTPMPVAPRQIPFHTGANYFELETRNSDLWRQLEQS
GGIAMHIAGDFPGLDLAFWAIRS
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|538392231|ref|NC_022247.1|:646308-647639 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGAGTTGGCGAACAAAAGTGGTCTGGAGCGAGGGGATGCTGCTGCAGCCCCAGCACCTGCAGCAAAGCG
AGCGTCATGCCGACCATGCGAGGCATGTGCTGTTGCGTTCCACCACGCCCTATGCCTGGGGGTTTGCGGA
GATCGAGATCGATCAGGCCGCGCTCACGCTGGGCAAGCTCGCCCTGGTGCGTGCGGTGGGCATCTTCGGC
GACGGCACGGTGTTCGACATGCCGGCGGTCGATCCGCTGCCCGAGCCCATCGACATTCCGCCCGCCATGC
GCGACGAGGCCGTGATGCTGGCGCTGCCGCTGCGCCGCGCCGGCGCCCGCGAGGCCGACGCCGAAGACTA
TGAAGAGCTGGTGCGCCACCGGGTGCTCGAGTCCGAGGTGCCGGACTCCAACACCGCCGGCGAGCGCACG
GCCGTGCTGCAGCTGGGCCAGCTCCACACGCGCCTGATGCGTGCCAGCGAAGCGACCGACGCCTGGACCA
CGCTGGGCGTGGCCCGCGTGGTCGAGCGCCGCGTCGACAACCAGGTGCAGCTCGAGCGCGCGATGCTGCC
GCCGCTGCTGGACGTGGCGGGCCACGGCGTGATCCGTTCCTGGCTCGACGAGTTGCTGGGCCTCCTGCGC
CAGCGCGGCGAGGCGCTGGCCGGGCGCATGACGCAGGGCGGCACCGGCGGCGTGGCCGAGATCGCGGACT
TCATGCTGCTGCAGACCGTCAACCGCAACGAGGCGGTCTTTGCGCACCTGGCCCGAAGCGCCATGCTGCA
CCCGCAGCGCTTCTTCGAGCTTGCGCTCGGGCTGGCCGGCGACCTCGCGAGCTTTCGCGATTCGCGCCGC
GTGGCGCGCTTCGGCCCCTACATCCACGACGACCTGGCGCTGAGCTTCCGTCCGCTGATGGACGACCTGC
GGCGCAGCCTCTCGATGGTGCTGGAGCAGTCGGCCATCCGCATCGACCTGCACGACCGCAAGCACGGCGT
GCGCGTGGCCATGGTGACCGACGTGGAGCTGCAGCGCAAGGCGACCTTCGTGCTCGCGGTGAACGCCAAC
ATGCCGAGCGAGGCGCTGCGCGCGCGCTTTCCCACGCAGGTCAAGATCGGCCCGGTCGAGCGCATCCGCG
ACCTGGTCAACCTGGCGCTGCCGGGCGTCACGCTCACGCCCATGCCGGTGGCGCCGCGCCAGATTCCCTT
CCACACCGGCGCCAACTACTTCGAGCTCGAAACGCGCAACAGCGACCTGTGGCGCCAGCTGGAGCAGTCG
GGCGGCATCGCGATGCACATCGCGGGCGACTTTCCCGGCCTCGACCTCGCGTTCTGGGCCATTCGTTCCT
AG
 Primer design