SecReT6
Protein ID: 538392823
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c05930
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]647672..649000 [+]
Productputative type IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDT1X560
KEGG IDvpd:VAPA_1c05930
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.50E-69, Aligned region: 56..261
OmpA [PF00691], Evalue: 5.30E-15, Aligned region: 325..422
Protein Sequence: 442 a.a.     [Download]
>gi|538392823|ref|YP_008514396.1| putative type IV / VI secretion system protein, DotU family [Variovorax paradoxus B4]
MTTPDPFAAFESERTVIKPKPRTPAGTPPPAAAPAPFFGGVDPTPAVDVGEIGLLNPLVSAAGKLLVLIG
KLRNLAQPPNVPALRASTADAVNQFDAAARRAGVSNESVLAARYVLCTALDEAVANTPWGVQAGWNKQSL
LVQFHNETWGGEKVFQLLAKLAQDVPTHRQLLELIYSVLALGFEGRYRVVDNGRAQLDSVRQRLADLIAK
DRPPLEAELSPHWRGQGAGTVRLRESLPLWVFAAGFALLLALAWFGLRLTLNYRSDTTYAAVSGLRVPNI
QIAPPAAPAKSPRLARFLEPEIKQGLVTVTDEADRSVVRLRGDSFFGSGSAEPMAASLPVLRRIGQALAE
VKGEVLITGHSDNQPIRSLRYPSNWHLSAARADAVKGALTTLVDPARMRSDGKADAEPVAANDTPANRAR
NRRVDIVLLSEPDRVAAAGVTK
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|538392231|ref|NC_022247.1|:647672-649000 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGACAACACCCGATCCCTTCGCCGCCTTCGAGTCGGAGCGCACGGTCATCAAGCCGAAGCCGCGCACGC
CGGCCGGCACGCCGCCGCCTGCTGCGGCACCGGCGCCTTTCTTCGGCGGCGTTGATCCGACACCCGCCGT
CGACGTCGGCGAGATCGGGCTGCTCAATCCGCTGGTCTCGGCCGCGGGCAAGCTGCTGGTGCTGATCGGA
AAGCTGCGCAACCTTGCGCAGCCGCCCAACGTGCCGGCCCTGCGCGCCTCCACCGCCGACGCGGTGAACC
AGTTCGACGCCGCCGCGCGCCGTGCCGGCGTCAGCAACGAATCGGTGCTGGCCGCGCGCTATGTGCTGTG
CACCGCGCTGGACGAGGCCGTGGCCAACACGCCCTGGGGCGTGCAGGCCGGCTGGAACAAGCAGAGCCTG
CTGGTGCAGTTCCACAACGAGACCTGGGGCGGCGAGAAGGTGTTCCAGTTGCTCGCCAAGCTCGCGCAGG
ACGTGCCCACGCACCGCCAGCTGCTGGAGCTGATCTACAGCGTGCTCGCGCTCGGCTTCGAAGGCCGCTA
CCGCGTGGTCGACAACGGCCGCGCGCAGCTCGATTCGGTGCGCCAGCGCCTGGCCGACCTGATCGCCAAG
GACCGTCCGCCGCTCGAAGCCGAGCTCTCGCCGCATTGGCGCGGGCAGGGCGCGGGCACGGTGCGGCTGC
GCGAATCGCTGCCGCTGTGGGTGTTCGCGGCCGGCTTCGCCCTGCTGCTCGCGCTGGCCTGGTTCGGCCT
GCGGCTCACGCTCAACTACCGCTCCGACACCACCTATGCCGCAGTGTCGGGCCTGCGCGTGCCCAACATC
CAGATCGCGCCGCCCGCCGCGCCGGCCAAGTCGCCGCGGCTCGCGCGCTTCCTCGAGCCCGAGATCAAGC
AGGGCCTCGTCACCGTGACCGACGAGGCCGACCGCAGCGTGGTGCGGCTGCGCGGCGACTCCTTCTTCGG
CTCCGGCAGCGCCGAGCCGATGGCCGCATCGCTGCCGGTGCTGCGCCGCATCGGCCAGGCGCTGGCCGAA
GTGAAGGGCGAGGTGCTGATCACCGGCCACTCCGACAACCAGCCGATCCGCTCGCTGCGCTATCCCTCCA
ACTGGCACCTGTCGGCCGCGCGTGCCGATGCGGTGAAGGGCGCGCTCACCACGCTGGTCGATCCGGCACG
CATGCGCTCCGACGGCAAGGCCGACGCCGAGCCCGTGGCCGCCAACGACACGCCGGCCAACCGCGCGCGC
AACCGGCGCGTCGACATCGTGCTGCTGTCCGAGCCGGACCGGGTCGCTGCCGCGGGAGTGACGAAATGA
 Primer design