SecReT6
Protein ID: 538392824
SecReT6 ID846
T6SS typei3
Gene symbolicmF2
Locus tagVAPA_1c05940
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]648997..652596 [+]
Productputative type VI secretion protein IcmF
NoteTssM
UniProt IDT1X5W8
KEGG IDvpd:VAPA_1c05940
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 206..472
ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 493..585
IcmF-related [PF06761], Evalue: 1.70E-88, Aligned region: 487..511
IcmF-related [PF06761], Evalue: 1.70E-88, Aligned region: 520..832
DUF1215 [PF06744], Evalue: 6.40E-32, Aligned region: 937..1058
Protein Sequence: 1199 a.a.     [Download]
>gi|538392824|ref|YP_008514397.1| putative type VI secretion protein IcmF [Variovorax paradoxus B4]
MIKKFFGFLFSPLLLTLLALVIVALLVWWIGPLVKIGAWVPLESELARALLIGAIVLIVVLRAIYRRWRA
RRASQHLTDGLMKAPTVKTDAPVNGEQKILDTRFSEAVATLKQMRLHAAGKKPGWRDWLSISGGSYLYDL
PWYVFIGAPGAGKTTALVNSGLSFPLAEKFGPGAIRGVGGTRNCDWWFTDEAVLIDTAGRYTTQDSHQSE
DKSAWEGFLGLLKKARPRRPLNGVFLTVSVADLLSQGPEQRTQLAASIRARLLELDAKLTTRLPVYVLVT
KSDLLYGFTDYFDDLGKEQRAQVFGFTLAADENVQADEKGLSTAFHREFALLHNRVNDGLIARMQRETDG
TRRAAIFGFPAQFGSIGSMLSDLLDQVFTGSRFAQPPWVRGVYFTSGTQEGSPIDRVMGSLARSFGIERA
MLAPQKSSGRSYFLTALLREVVFPEQRLAGANVKLERRRHALRMAGVAAMTLVTLALLAGWGYSTLQNVN
YLKSVEARVEPARQTLAALPSRVQNLVEVAPVLQGLRDIWKTPDNRQGDEPLSMTLGLYQGDKLDAAAML
THQRALNDAFLPQIAKRIEDQLRTAQKDNLEYTYEALKSYLMLYQPEHFDAEALKAWITLDWARSLDRGI
PEDQRQALEDQLDVLIAQGPPRSPLKMDENLVRSVRAVLASYPLEQRVFSRLKRQRATKDIPGFSIATAA
GPSAPLVFERISGKPLTEGVPGMFTYDGYHKRFQNEVTVLTGLLAQEDPWVLGQDRSATDRMRDVAALGA
LTDRVRRLYLAEYVKVWEALLADVRLIRASGLEKNIEAARILSGVGSPLANFLRAVVKETTLIPADQPKD
VVSKATATVANTRKGLEDLFGGDPNKPVASGKRIESIVDDRFEPLRRLVTAAGPNQPAPIDDALKLFNEV
YVYLNAVDTAVKGRTSPPPGDVAGKLKSDAGRLPEPVRTMVENLSQSGAAQAQVAERGNLSQDLRPVTDF
CNRAIAGRYPFVGSSKRDVLPEDFGQMFGAGGLMDEFFQKRLAALVDTSTKPWRYKPVAERGAVTTQALA
QFERAARIKDIFFRGGGRGPSMRLDFKPVEMDAGITQFILDVDGQLVKYAHGPVVPMAVQWPGPKGSNQV
RIQVSPPSTTGSSGAAVDGPWALFRALDDGQLEAGDAPEKFFITFQIGARKTRFEVTTNSVQHPIRLKEL
REFSCPEGL
 
Nucleotide Sequence: 3600 bp     [Download]
>gi|538392231|ref|NC_022247.1|:648997-652596 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGATCAAGAAATTCTTCGGCTTCCTGTTCAGCCCGCTGCTGCTGACCCTGCTGGCGCTGGTCATCGTCG
CGCTGCTGGTCTGGTGGATCGGCCCGCTGGTGAAGATCGGTGCGTGGGTGCCGCTCGAAAGCGAGCTTGC
ACGCGCGCTGCTGATCGGCGCCATCGTGCTCATCGTGGTGCTGCGCGCGATCTACCGCAGGTGGCGCGCG
CGCCGTGCGAGCCAGCACCTGACCGACGGCCTCATGAAGGCCCCCACCGTCAAGACCGACGCCCCGGTCA
ACGGCGAACAGAAGATCCTCGACACGCGCTTCAGCGAAGCCGTGGCCACGCTGAAGCAGATGCGCCTGCA
TGCCGCGGGCAAGAAGCCCGGCTGGCGCGACTGGCTTTCCATTTCCGGTGGCAGCTATCTGTACGACCTG
CCTTGGTACGTGTTCATCGGCGCGCCGGGCGCGGGCAAGACCACGGCGCTGGTCAACTCGGGCCTGTCGT
TCCCGCTGGCCGAGAAGTTCGGCCCCGGCGCGATCCGCGGCGTGGGCGGCACGCGCAACTGCGACTGGTG
GTTCACCGACGAGGCCGTGCTCATCGACACCGCCGGCCGCTACACCACGCAGGACAGCCACCAGTCGGAA
GACAAGAGCGCATGGGAGGGCTTCCTCGGCCTGCTCAAGAAGGCGCGCCCGCGCCGGCCGCTCAACGGCG
TGTTCCTGACCGTGAGCGTGGCCGACCTGCTGAGCCAGGGCCCCGAGCAGCGCACGCAGCTGGCCGCATC
CATCCGCGCGCGGCTGCTCGAGCTCGATGCGAAGCTCACCACGCGGCTGCCGGTGTACGTGCTCGTCACC
AAGAGCGATCTGCTCTATGGCTTCACCGACTACTTCGACGACCTCGGCAAGGAGCAGCGCGCGCAGGTCT
TCGGCTTCACGCTGGCGGCCGACGAGAACGTGCAGGCCGACGAGAAGGGGCTGTCCACCGCCTTCCACCG
CGAGTTCGCGCTGCTGCACAACCGCGTCAACGACGGCCTCATCGCACGCATGCAGCGCGAGACCGACGGC
ACGCGGCGCGCGGCGATCTTCGGTTTTCCGGCGCAGTTCGGCTCCATCGGCTCGATGCTGTCCGACCTGC
TCGACCAGGTCTTCACCGGCTCGCGCTTCGCGCAGCCGCCGTGGGTGCGCGGCGTGTACTTCACCAGCGG
CACGCAGGAAGGCAGCCCGATCGACCGCGTGATGGGCAGCCTGGCACGCAGCTTCGGCATCGAGCGCGCG
ATGCTCGCGCCGCAGAAGTCGAGCGGCCGCAGCTACTTTCTCACCGCGCTGCTGCGCGAGGTGGTGTTCC
CCGAGCAGCGGCTGGCCGGCGCGAACGTGAAGCTCGAACGGCGGCGCCACGCGCTGCGCATGGCGGGCGT
GGCGGCCATGACGCTGGTCACGCTCGCGCTGCTCGCGGGCTGGGGCTACAGCACGCTGCAGAACGTCAAT
TACCTGAAGTCGGTCGAGGCGCGCGTCGAGCCCGCGCGCCAGACCCTTGCGGCCCTGCCTTCGCGGGTGC
AGAACCTGGTGGAGGTGGCGCCCGTGCTGCAGGGCCTGCGCGACATCTGGAAGACGCCCGACAACCGCCA
GGGCGACGAGCCGCTGTCGATGACGCTCGGCCTCTACCAGGGCGACAAGCTCGACGCTGCCGCCATGCTC
ACGCACCAGCGCGCGCTCAACGACGCCTTCCTGCCGCAGATCGCCAAGCGCATCGAGGACCAGCTGCGCA
CCGCGCAGAAGGACAACCTCGAGTACACCTACGAGGCGCTCAAGAGCTACCTCATGCTCTACCAGCCCGA
GCACTTCGATGCCGAGGCGCTCAAGGCCTGGATCACGCTCGACTGGGCGCGCAGCCTGGACCGCGGCATT
CCCGAAGACCAGCGCCAGGCGCTCGAAGACCAGCTCGACGTGCTCATCGCGCAAGGCCCGCCGCGTTCGC
CGCTCAAGATGGACGAGAACCTGGTGCGCAGCGTGCGCGCCGTGCTCGCGAGCTATCCGCTGGAGCAGCG
CGTGTTCAGCCGCCTGAAGCGCCAGCGCGCCACCAAGGACATTCCGGGCTTCAGCATCGCCACGGCCGCG
GGCCCTTCGGCGCCGCTGGTGTTCGAGCGCATCAGCGGCAAGCCGCTGACCGAAGGTGTGCCGGGCATGT
TCACCTACGACGGCTACCACAAGCGCTTCCAGAACGAGGTCACGGTGCTCACCGGCCTGCTCGCGCAGGA
AGACCCGTGGGTGCTCGGGCAGGACCGCAGCGCCACCGACCGCATGCGCGACGTGGCGGCGCTCGGCGCG
CTGACCGATCGCGTGCGCCGGCTCTACCTGGCGGAGTACGTCAAGGTCTGGGAGGCCCTGCTGGCCGACG
TGCGGCTGATCCGCGCCAGCGGGCTCGAGAAGAACATCGAGGCCGCGCGCATTCTCTCGGGCGTGGGTTC
GCCGCTTGCGAACTTCCTGCGCGCGGTGGTGAAGGAAACCACGCTCATTCCCGCCGACCAGCCCAAGGAC
GTGGTGAGCAAGGCCACCGCCACGGTCGCCAACACCCGCAAGGGCCTGGAAGACCTGTTCGGCGGCGACC
CGAACAAGCCCGTGGCCAGCGGCAAGCGCATCGAGAGCATCGTGGACGACCGCTTCGAACCGCTGCGCCG
CCTCGTCACTGCTGCCGGGCCGAACCAGCCCGCGCCGATCGACGATGCGCTCAAGCTTTTCAACGAGGTG
TACGTGTACCTCAACGCCGTCGACACGGCCGTGAAGGGCCGCACCTCGCCGCCGCCCGGCGACGTGGCCG
GCAAGCTCAAGTCCGACGCGGGCCGCCTGCCCGAGCCGGTGCGCACGATGGTCGAGAACCTGAGCCAGTC
GGGCGCGGCGCAGGCCCAGGTGGCCGAGCGCGGCAACCTGAGCCAGGACCTGCGTCCCGTGACCGATTTC
TGCAACCGCGCCATCGCGGGCCGCTATCCGTTTGTGGGCAGCAGCAAGCGCGACGTGCTGCCCGAGGACT
TCGGCCAGATGTTCGGCGCCGGCGGCCTGATGGACGAGTTCTTCCAGAAGCGGCTGGCCGCGCTGGTCGA
CACCAGCACGAAGCCGTGGCGCTACAAGCCGGTGGCCGAACGCGGCGCCGTCACCACGCAGGCGCTGGCG
CAGTTCGAGCGGGCCGCGCGCATCAAGGACATCTTCTTCCGCGGCGGCGGCCGCGGCCCGTCGATGCGGC
TCGACTTCAAGCCGGTGGAGATGGATGCGGGCATCACGCAATTCATCCTCGACGTGGACGGACAGCTCGT
GAAATACGCGCACGGCCCGGTGGTGCCCATGGCCGTGCAGTGGCCGGGGCCGAAGGGGAGCAACCAGGTG
CGCATCCAGGTCAGCCCGCCTTCGACCACCGGCAGTTCGGGTGCCGCGGTCGACGGGCCATGGGCGCTGT
TCCGCGCGCTCGACGACGGCCAGCTCGAAGCCGGCGATGCGCCCGAGAAGTTCTTCATCACTTTCCAGAT
CGGCGCCCGCAAGACGCGCTTCGAGGTGACGACGAACAGCGTGCAGCATCCGATCCGCCTGAAGGAACTG
CGCGAGTTCTCCTGTCCGGAGGGGTTGTGA
 Primer design

Protein ID: 538392859
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06290
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]694847..695965 [-]
ProductImcF-like N-terminal domain-containing protein
NoteTssM
UniProt IDT1X5Z6
KEGG IDvpd:VAPA_1c06290
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.80E-35, Aligned region: 149..338
ImcF-related_N [PF14331], Evalue: 6.80E-35, Aligned region: 334..362
Protein Sequence: 372 a.a.     [Download]
>gi|538392859|ref|YP_008514432.1| ImcF-like N-terminal domain-containing protein [Variovorax paradoxus B4]
MPAALSSAHFFWLLLALCLAGFALLYATVRDAGRGARRRALRRRIAALGPPAAEPDEAAVEAMRDAMSHA
RQLLRQPPRQQAAPVPWLLFLGDAAANLPGLLAAAHAEHLAPSGSEPFGEPYWRWWLTGSMTAIELHPSA
VSDVAAAPHTRALWLQALLALAERRDRVPINGVVVCVAASELLHPASAGMKPLATRMRRLLDEAAETLRL
RLPVYLVVTGLEQLAGYATLRGALPPEVLAQVIGHRLAGAAAHGETAAERLDALFDPMARQLHALRMALL
REQPSASGRLAIHEFVEALRALQPALRQVADALFESHGRGSRGPRWRGLYLTAAASGAAGGAFVTDLFER
FLPADQPLARPGRPPNANAAKA
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|538392231|ref|NC_022247.1|:c695965-694847 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGCCCGCCGCGCTGTCGTCCGCCCATTTCTTCTGGCTCCTGCTCGCGCTGTGCCTGGCCGGTTTTGCAC
TGCTGTACGCCACGGTCCGCGACGCCGGCCGCGGTGCGCGCCGCCGTGCGCTGCGCCGGCGCATTGCCGC
GCTCGGCCCACCGGCGGCCGAACCCGACGAAGCCGCGGTCGAAGCCATGAGGGACGCCATGTCGCACGCA
CGCCAGCTCCTGCGCCAGCCACCGCGGCAGCAAGCCGCGCCGGTGCCCTGGCTCCTCTTCCTCGGCGATG
CGGCGGCCAACCTGCCGGGGCTGCTGGCGGCGGCCCATGCCGAGCACCTGGCACCTTCAGGCAGCGAACC
TTTCGGCGAACCGTACTGGCGCTGGTGGCTCACCGGTTCGATGACGGCCATCGAGCTTCACCCGAGCGCC
GTCAGCGACGTGGCCGCGGCGCCGCACACGCGCGCGCTGTGGCTCCAGGCACTCCTCGCACTGGCCGAGC
GGCGCGACCGCGTGCCGATCAACGGCGTGGTGGTCTGCGTGGCAGCGAGCGAACTGCTGCACCCGGCCAG
CGCAGGCATGAAGCCGCTGGCCACCAGGATGCGCCGGCTGCTCGACGAGGCCGCGGAGACCCTGCGCCTG
CGGCTGCCGGTCTACCTGGTCGTGACCGGGCTGGAGCAGCTGGCCGGCTATGCCACGCTGCGCGGCGCGC
TGCCGCCCGAGGTGCTCGCACAGGTGATCGGCCATCGCCTGGCCGGAGCTGCCGCCCATGGCGAGACGGC
GGCCGAACGGCTCGATGCCCTGTTCGATCCCATGGCGCGCCAGCTGCATGCGCTGCGGATGGCGCTGCTG
CGCGAACAGCCGAGTGCATCGGGCCGGCTCGCGATCCATGAGTTCGTCGAGGCGCTGCGTGCGCTGCAAC
CCGCATTGCGCCAGGTGGCCGACGCCCTGTTCGAAAGCCATGGCCGCGGCTCGCGCGGCCCGCGATGGCG
CGGCCTCTATCTCACAGCCGCTGCATCGGGCGCGGCCGGCGGCGCGTTCGTGACCGATCTGTTCGAGCGC
TTCCTGCCCGCCGACCAACCGCTCGCACGGCCCGGCCGTCCGCCGAACGCCAACGCGGCAAAGGCGTGA
 Primer design