SecReT6
Protein ID: 538392832
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06020
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]661627..662427 [+]
ProductImpE family protein
NoteTagJ
UniProt IDT1X4A4
KEGG IDvpd:VAPA_1c06020
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.70E-42, Aligned region: 138..260
Protein Sequence: 266 a.a.     [Download]
>gi|538392832|ref|YP_008514405.1| ImpE family protein [Variovorax paradoxus B4]
MATSAELLKSADPVAALKALSDEVRAKPADSKHRVFMAQLLCVLGQWERALNQLTVAAELDALAVPMKQV
YGDAVRCEGLRAEVFAGTRTPMVFGQPDEWLALLIESLLRQGRGESELAEDLRQRAFDGAPAIAGTIDGA
PFEWLADADMRLGPVLEAFVNGKYYWIPYARLAHIKIDPPEDLRDCVWMPAHLQFENGGETLALIPTRYE
GTEKSEDGELLLARKTEWRELRPEVWAGCGQRVLGSDAGEYALMDVREILFESQGA
 
Nucleotide Sequence: 801 bp     [Download]
>gi|538392231|ref|NC_022247.1|:661627-662427 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGCCACCTCTGCCGAACTCCTCAAGTCCGCCGACCCCGTCGCCGCGCTCAAGGCCCTCAGCGACGAGG
TCCGCGCCAAGCCCGCCGACAGCAAGCACCGCGTCTTCATGGCGCAGCTGCTGTGCGTGCTGGGTCAATG
GGAACGCGCGCTCAACCAGCTCACCGTCGCGGCCGAGCTCGATGCGCTCGCCGTTCCCATGAAGCAGGTG
TACGGCGACGCCGTGCGCTGCGAAGGCCTGCGCGCCGAGGTGTTTGCCGGCACGCGCACGCCCATGGTCT
TCGGCCAGCCCGACGAATGGCTGGCGCTGCTCATCGAATCGCTGCTGCGCCAGGGCCGCGGCGAGAGCGA
GCTGGCCGAGGACCTTCGCCAGCGGGCCTTCGACGGTGCACCCGCCATCGCCGGCACCATCGACGGCGCG
CCCTTCGAATGGCTGGCCGATGCCGACATGCGCCTGGGCCCCGTGCTCGAAGCCTTCGTCAACGGCAAGT
ACTACTGGATTCCCTACGCCCGGCTCGCGCACATCAAGATCGATCCGCCCGAGGACCTGCGCGACTGCGT
CTGGATGCCCGCGCACCTGCAGTTCGAGAACGGCGGCGAAACGCTGGCGCTCATTCCCACCCGCTACGAA
GGCACCGAGAAGAGCGAAGACGGCGAGCTGCTTCTCGCGCGCAAGACCGAGTGGCGCGAACTGCGGCCCG
AGGTCTGGGCCGGCTGCGGCCAGCGCGTGCTCGGCAGCGACGCCGGCGAGTACGCGCTCATGGACGTGCG
CGAGATCCTCTTCGAAAGCCAGGGCGCATAG
 Primer design