SecReT6
Protein ID: 538392833
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06030
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]662430..662945 [+]
Productputative type VI secretion system protein, lysozyme-like protein
NoteTssE
UniProt IDT1X569
KEGG IDvpd:VAPA_1c06030
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.80E-17, Aligned region: 36..147
Protein Sequence: 171 a.a.     [Download]
>gi|538392833|ref|YP_008514406.1| putative type VI secretion system protein, lysozyme-like protein [Variovorax paradoxus B4]
MAELTAQERLQPSLLDRLVDDAPSEKRESDERRTLTKQALRSAVLRDLSWLFNATGFGLAMDDKQYPNAA
RSVINYGLPMLSGQFTSSVQRVSMEQALKNAILQFEPRILSRTLEVELVMEGSALDSHNSIGLQIRGMLW
AQPVPLEFLMRSRVDLEEGRIEIVDMAQNPR
 
Nucleotide Sequence: 516 bp     [Download]
>gi|538392231|ref|NC_022247.1|:662430-662945 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGCCGAACTCACCGCCCAGGAACGCCTGCAGCCGTCGCTGCTCGACCGCCTGGTCGACGACGCGCCCA
GCGAAAAGCGCGAGAGCGACGAGAGGCGCACGCTCACCAAGCAGGCGCTGCGCTCGGCCGTGCTGCGCGA
CCTGAGCTGGCTCTTCAACGCCACCGGCTTCGGGCTTGCCATGGACGACAAGCAATACCCGAACGCCGCA
CGCTCGGTCATCAACTACGGATTGCCTATGCTGTCTGGCCAGTTCACCTCGTCGGTGCAGCGTGTCAGCA
TGGAACAGGCTTTGAAGAACGCAATCCTGCAGTTCGAGCCGCGCATTTTGTCCCGCACTCTCGAAGTTGA
ACTCGTCATGGAAGGCTCGGCACTCGACTCGCACAACAGCATCGGCCTGCAGATCCGCGGCATGCTGTGG
GCGCAGCCCGTGCCGCTCGAGTTCCTGATGCGAAGCCGTGTAGACCTGGAAGAAGGACGCATCGAGATCG
TGGACATGGCGCAAAACCCAAGGTAA
 Primer design