SecReT6
Protein ID: 538392834
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06040
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]662953..664845 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDT1X5X7
KEGG IDvpd:VAPA_1c06040
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-196, Aligned region: 5..630
Protein Sequence: 630 a.a.     [Download]
>gi|538392834|ref|YP_008514407.1| type VI secretion protein, VC_A0110 family [Variovorax paradoxus B4]
MDPRLLNLYEQELRYFRESSSEFARAFPKIAHRLGIEGQEVADPYVERLIEATAFLSARVNLKLDAEYPR
FTGHLLDIVYPNFLAPTPAMAVVSFSPDLDDANLATGPRLPRGAGLRARQAVGQNTHCEFRTSSALRIWP
IEIQRAQYFTYAPDLPLGTHPQSRAIRGGLRIALHATAGLNFSQIALDDLVLHLGGAEDVAWQLQECALG
QPIGVMVRPLSPTGALQGAAQSLPATAIQPVGFEDDEALLPVTATGFSGFRLLQEYFAFPQRFQFLRIAG
LQSVLAAMPVAEVELVLLFSRGDAALEKLVSADNVQLHCVPVVNLFNKRLDRVPLTEGVSQFHLVPDRTR
PQDFEVHTVTEVIGHGAPGVDASAAEQVFRPFYSAFHGTRHSHPAYFTTTREPRMLSVRQRTEGHRSSHI
GSEVYMQIVDPQQAPYAATLRQLAVAALCTNRDLPLLMPLGRDNDFDCVDSFPVQRVRMVRGPSRPVSPV
VSQGLGWRVVDHLALNYLSISDSTPEQGAAALRETLMLYATHADEMRQGQVRGLLSVRAKPVARRLPLKG
PIAFGRGLEVTLEVDKDAFHGHSVFLFGAVMARFLARHVEVNHFVETVLRVAGKGETMRWRPLCGTRQIL
 
Nucleotide Sequence: 1893 bp     [Download]
>gi|538392231|ref|NC_022247.1|:662953-664845 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGACCCTCGGCTGCTGAACCTGTATGAACAGGAACTGCGCTATTTCCGCGAGAGCTCCTCGGAGTTCG
CGCGCGCCTTTCCGAAGATCGCGCACCGCCTGGGCATCGAAGGCCAGGAGGTCGCCGATCCGTACGTCGA
GCGGCTGATCGAGGCCACGGCCTTCCTGTCGGCGCGCGTCAACCTCAAGCTCGATGCCGAATACCCGCGT
TTCACGGGCCACCTGCTCGACATCGTCTATCCGAATTTCCTCGCGCCCACGCCGGCGATGGCGGTCGTCT
CCTTCTCGCCCGATCTCGACGACGCCAACCTCGCGACCGGTCCCAGGCTGCCGCGCGGCGCCGGGCTGCG
CGCGCGGCAGGCCGTGGGGCAGAACACGCATTGCGAGTTCCGCACCTCGAGCGCGCTGCGCATCTGGCCG
ATCGAGATCCAGCGCGCCCAGTACTTCACCTATGCGCCCGACCTGCCGCTCGGAACGCACCCCCAGTCCC
GTGCCATCCGCGGCGGCCTGCGCATTGCGCTGCATGCGACGGCGGGGCTCAACTTCAGCCAGATCGCGCT
CGACGACCTGGTGCTGCATCTCGGCGGCGCCGAAGACGTGGCATGGCAGTTGCAGGAGTGCGCGCTGGGC
CAGCCCATCGGCGTGATGGTGCGGCCGCTGTCGCCCACCGGCGCGCTGCAGGGCGCGGCGCAGAGCCTGC
CGGCCACGGCGATCCAGCCCGTCGGCTTCGAGGACGATGAAGCGCTGCTGCCGGTCACGGCCACCGGCTT
CTCGGGCTTCCGCCTGCTGCAGGAGTACTTCGCGTTTCCACAGCGCTTCCAGTTCCTGCGTATCGCGGGG
CTGCAATCGGTGCTCGCGGCGATGCCGGTCGCCGAGGTCGAGCTCGTGCTGCTGTTCTCGCGCGGCGATG
CGGCACTCGAAAAACTGGTGAGCGCCGACAACGTGCAGCTGCACTGCGTGCCGGTGGTCAATCTGTTCAA
CAAGCGGCTCGACCGTGTGCCGCTGACCGAAGGCGTGAGCCAGTTCCACCTGGTGCCCGACCGCACGCGG
CCGCAGGATTTCGAGGTGCACACCGTTACCGAGGTCATCGGCCACGGCGCGCCCGGCGTCGATGCATCGG
CGGCCGAACAGGTGTTTCGCCCTTTCTATTCGGCCTTCCATGGCACGCGGCACAGCCACCCGGCCTACTT
CACGACCACCCGCGAGCCGCGGATGCTGTCGGTGCGCCAGCGCACCGAGGGCCATCGCAGCAGCCACATC
GGCTCCGAGGTCTACATGCAGATCGTCGATCCGCAGCAGGCGCCGTACGCCGCCACGCTGCGGCAGCTCG
CGGTGGCCGCGCTGTGCACCAACCGCGACCTGCCGCTCCTGATGCCGCTGGGGCGCGACAACGACTTCGA
TTGCGTCGACTCCTTCCCCGTGCAGCGGGTGCGCATGGTTCGCGGTCCTTCGCGGCCGGTGTCGCCGGTG
GTGAGCCAGGGGCTGGGCTGGCGGGTGGTCGATCACCTTGCGCTCAACTACCTGTCGATCTCCGACAGCA
CGCCGGAGCAGGGCGCTGCCGCATTGCGCGAAACGCTGATGCTCTACGCCACGCATGCCGACGAGATGCG
CCAGGGCCAGGTGCGCGGGCTGCTCTCGGTGAGAGCCAAGCCCGTGGCGCGCCGCCTGCCGCTCAAGGGA
CCGATCGCCTTCGGGCGCGGGCTCGAAGTGACGCTCGAGGTCGACAAGGACGCATTCCACGGCCACAGCG
TGTTCCTGTTCGGCGCGGTGATGGCGCGCTTTCTCGCGCGCCACGTGGAGGTCAACCATTTCGTCGAGAC
CGTGCTGCGCGTGGCGGGCAAGGGCGAGACCATGCGATGGAGGCCGCTATGCGGGACCCGGCAGATTCTG
TGA
 Primer design