SecReT6
Protein ID: 538392835
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06050
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]664842..665990 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDT1X6E9
KEGG IDvpd:VAPA_1c06050
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-95, Aligned region: 44..352
Protein Sequence: 382 a.a.     [Download]
>gi|538392835|ref|YP_008514408.1| type VI secretion protein, VC_A0111 family [Variovorax paradoxus B4]
MSAARPPEGARPLAREGGGEVREAASPGESVNTRVDNALRGWSAEPWSYDYFAVLRRLESVAATTPRWGR
ALLPSAEPVRVGQEPSLSFAPASFSRFEPASAHSPPRLRQHFFSYVGPNGPLPVHLSDFIRERSLNHGDP
TWLAFLDSFLHRFSLHFYRAWAQARPAVALDRPGEDRFRLQVGAFVGIGTPGRIERDEVHDDARLHFSGW
LARRVHNAESVESVLCSYFGVPVALERWVGHWMSLPAGELTRLGQGESSRSMGMGAMLGTRAWDRQHRVR
LHIGPLTLAQYRMFLPIGNARPVLQRWMQQLLGDELEWDAELVLETTQVPVTRLGKAKGNAPRLGWVSWL
GQRTRAKDAADVRIGNSSMTARTAQATVGAAA
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|538392231|ref|NC_022247.1|:664842-665990 Variovorax paradoxus B4 chromosome 1, complete sequence
GTGAGCGCCGCCCGGCCGCCCGAAGGCGCTCGCCCCCTCGCTCGCGAGGGGGGAGGCGAAGTCCGCGAAG
CGGCGAGCCCGGGGGAGTCAGTCAACACGCGTGTCGACAACGCGCTGCGCGGGTGGTCGGCGGAGCCGTG
GTCCTACGACTATTTCGCGGTGCTGCGCCGGCTGGAATCGGTGGCCGCGACCACGCCGCGCTGGGGCCGC
GCATTGCTGCCGAGCGCGGAGCCGGTGCGCGTGGGGCAGGAGCCGTCGCTGTCGTTCGCGCCGGCCAGCT
TCAGCCGCTTCGAACCGGCAAGCGCCCACTCGCCGCCGCGCCTGCGCCAGCATTTCTTCAGCTACGTCGG
GCCCAACGGTCCTCTGCCGGTTCACCTGAGCGACTTCATCCGCGAGCGCAGCCTGAACCATGGCGACCCG
ACCTGGCTGGCCTTTCTCGACAGCTTTCTGCACCGCTTCTCGCTGCACTTCTATCGCGCGTGGGCGCAGG
CGCGGCCCGCAGTGGCGCTCGACCGGCCGGGCGAGGACCGCTTCCGCCTGCAGGTCGGCGCGTTCGTGGG
CATCGGCACGCCGGGGCGCATCGAGCGCGACGAGGTGCACGACGATGCCCGCCTTCATTTCTCGGGCTGG
CTCGCGCGCCGCGTGCACAACGCCGAGAGCGTGGAGTCGGTGCTGTGCAGTTACTTCGGCGTGCCGGTGG
CGCTGGAGCGCTGGGTCGGCCACTGGATGAGCCTGCCCGCCGGCGAGCTCACGCGGCTGGGGCAGGGCGA
GAGTTCGCGCTCGATGGGCATGGGCGCGATGCTCGGCACGCGTGCGTGGGACCGGCAGCACCGCGTGCGC
CTGCACATCGGCCCGCTCACGCTCGCGCAGTACCGCATGTTCCTGCCGATCGGCAACGCGAGGCCGGTGC
TGCAGCGCTGGATGCAGCAGTTGCTCGGGGACGAACTCGAATGGGACGCCGAGCTGGTGCTCGAGACGAC
GCAGGTGCCCGTTACGCGCCTCGGCAAGGCGAAGGGCAACGCGCCGCGCCTGGGCTGGGTCTCCTGGCTC
GGCCAGCGCACGCGCGCGAAGGACGCGGCGGACGTGCGCATCGGCAACAGCTCGATGACCGCCCGTACCG
CCCAGGCCACTGTGGGAGCCGCCGCATGA
 Primer design