SecReT6
Protein ID: 538392837
SecReT6 ID846
T6SS typei3
Gene symbolclpV1
Locus tagVAPA_1c06070
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]667391..670120 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDT1X4A8
KEGG IDvpd:VAPA_1c06070
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.30E-39, Aligned region: 233..312
AAA_2 [PF07724], Evalue: 3.30E-39, Aligned region: 641..807
AAA [PF00004], Evalue: 1.60E-20, Aligned region: 235..368
AAA [PF00004], Evalue: 1.60E-20, Aligned region: 647..731
ClpB_D2-small [PF10431], Evalue: 8.60E-15, Aligned region: 216..229
ClpB_D2-small [PF10431], Evalue: 8.60E-15, Aligned region: 814..892
AAA_5 [PF07728], Evalue: 2.00E-12, Aligned region: 235..259
AAA_5 [PF07728], Evalue: 2.00E-12, Aligned region: 646..763
AAA_16 [PF13191], Evalue: 5.30E-12, Aligned region: 35..71
AAA_16 [PF13191], Evalue: 5.30E-12, Aligned region: 213..257
AAA_16 [PF13191], Evalue: 5.30E-12, Aligned region: 279..313
AAA_16 [PF13191], Evalue: 5.30E-12, Aligned region: 638..691
AAA_22 [PF13401], Evalue: 6.30E-08, Aligned region: 235..316
AAA_22 [PF13401], Evalue: 6.30E-08, Aligned region: 369..401
AAA_22 [PF13401], Evalue: 6.30E-08, Aligned region: 644..673
Sigma54_activat [PF00158], Evalue: 1.50E-07, Aligned region: 219..260
Sigma54_activat [PF00158], Evalue: 1.50E-07, Aligned region: 646..765
AAA_14 [PF13173], Evalue: 1.30E-06, Aligned region: 235..325
AAA_14 [PF13173], Evalue: 1.30E-06, Aligned region: 645..743
NACHT [PF05729], Evalue: 1.40E-05, Aligned region: 235..321
NACHT [PF05729], Evalue: 1.40E-05, Aligned region: 647..673
AAA_17 [PF13207], Evalue: 2.30E-05, Aligned region: 235..274
AAA_17 [PF13207], Evalue: 2.30E-05, Aligned region: 646..682
AAA_19 [PF13245], Evalue: 2.50E-05, Aligned region: 234..258
AAA_19 [PF13245], Evalue: 2.50E-05, Aligned region: 644..668
Zeta_toxin [PF06414], Evalue: 2.60E-05, Aligned region: 234..258
Zeta_toxin [PF06414], Evalue: 2.60E-05, Aligned region: 638..696
AAA_18 [PF13238], Evalue: 9.30E-05, Aligned region: 235..259
AAA_18 [PF13238], Evalue: 9.30E-05, Aligned region: 648..675
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 213..256
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 286..318
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 645..667
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 219..257
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 646..667
AAA_29 [PF13555], Evalue: 0.00057, Aligned region: 227..251
AAA_29 [PF13555], Evalue: 0.00057, Aligned region: 643..671
AAA_25 [PF13481], Evalue: 0.0007, Aligned region: 217..262
AAA_25 [PF13481], Evalue: 0.0007, Aligned region: 287..327
AAA_25 [PF13481], Evalue: 0.0007, Aligned region: 644..671
DUF815 [PF05673], Evalue: 0.0018, Aligned region: 212..311
DUF815 [PF05673], Evalue: 0.0018, Aligned region: 645..687
NTPase_1 [PF03266], Evalue: 0.0033, Aligned region: 235..258
NTPase_1 [PF03266], Evalue: 0.0033, Aligned region: 286..312
NTPase_1 [PF03266], Evalue: 0.0033, Aligned region: 646..668
Clp_N [PF02861], Evalue: 0.0047, Aligned region: 28..70
Hpr_kinase_C [PF07475], Evalue: 0.0054, Aligned region: 235..247
Hpr_kinase_C [PF07475], Evalue: 0.0054, Aligned region: 644..664
UPF0079 [PF02367], Evalue: 0.0073, Aligned region: 235..256
UPF0079 [PF02367], Evalue: 0.0073, Aligned region: 643..674
SRP54 [PF00448], Evalue: 0.0077, Aligned region: 234..258
SRP54 [PF00448], Evalue: 0.0077, Aligned region: 645..679
RNA_helicase [PF00910], Evalue: 0.0082, Aligned region: 236..256
RNA_helicase [PF00910], Evalue: 0.0082, Aligned region: 647..668
Protein Sequence: 909 a.a.     [Download]
>gi|538392837|ref|YP_008514410.1| type VI secretion ATPase, ClpV1 family [Variovorax paradoxus B4]
MSEISRTALFGKLNSLAYKAIEGATVFCKMRGNPYVELEHWFAQLLQAQDSDLHRVIQHYGLDVSVIAKD
MTAALDRLPRGATAISDFSPHIENAIERAWTYATLQFGEAQVRTGYILVGMLKTQSLRNPLFGLSRQFEK
IKVEDLADNFVKICDASPESQMRAQDGTGMGSGAPGEDSGAMAPAAMGKGDALKKFAVDLTEKARKGEMD
PITGRDEEIRQIVDILMRRRQNNPLLTGEAGVGKTAVVEGFAQRLARGDVPPQLKDVKLLTLDIGLLQAG
ASMKGEFEQRLRQVIDEVQSSPTPIILFIDEIHTLVGAGGAAGTGDAANLLKPALARGNLRTIGATTWAE
YKKYIEKDPALTRRFQVVQVPEPDEVKAILMLRGVASVLEKHHRVQLLDEAIEAAVKLSHRYIPARQLPD
KAVSLLDTACARVAVSQHATPPEVEDCMRRIEGLTVEQEIIGREEAIGIDVTKRAVQVAALLLESNGQLE
TLNARWKEEKGLVDRLLELRAKLRAGNKPVDAASTEGEAKADVPPPQPSPGGGGSEDRAALLEELHALQA
KIHAVQGESPLILPSVDEQAVASVVADWTGIPVGRMVKNEVEAVLKLADTLNQRVIGQKHGLEMIARRIQ
TSRARLDNPQKPIGVFMLCGTSGVGKTETALALAEALYGGEQNIITINMSEFQEAHTVSTLKGAPPGYVG
YGEGGILTEAVRRRPYSVVLLDEVEKAHPDVHEIFFQVFDKGWMEDGEGRMIDFKNTIILLTTNAGSELV
MSMCRDPELLPDSNALADALKAPLMKVFPPALLGRIVTIPYYPLSPDMMKKIVRLQLGRIKKRVETNHGV
PFEYSDAVVDQVVARCQDPESGGRVIDAILTNTVLPTISVEYLQRLASGGEIRRVALDVKDADFTYAFD
 
Nucleotide Sequence: 2730 bp     [Download]
>gi|538392231|ref|NC_022247.1|:667391-670120 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGAGTGAAATCAGTCGCACCGCCCTTTTCGGCAAGCTCAACTCGCTGGCCTACAAGGCCATCGAAGGCG
CCACGGTGTTCTGCAAGATGCGGGGCAATCCGTACGTGGAACTGGAGCACTGGTTCGCCCAGCTGCTGCA
GGCGCAAGACTCCGACCTGCATCGCGTGATCCAGCACTACGGCCTCGACGTCTCCGTGATCGCCAAGGAC
ATGACGGCCGCACTCGACCGCCTGCCACGCGGCGCCACCGCCATCAGCGACTTCTCCCCGCACATCGAGA
ACGCCATCGAACGCGCCTGGACCTATGCCACGCTGCAGTTCGGCGAGGCGCAGGTGCGCACCGGCTACAT
CCTGGTGGGCATGCTGAAGACGCAGAGCCTGCGCAATCCGCTGTTCGGCCTGTCCAGGCAGTTCGAGAAG
ATCAAGGTCGAGGACCTGGCCGACAACTTCGTGAAGATTTGCGACGCCTCGCCCGAATCGCAGATGCGCG
CGCAGGACGGCACCGGCATGGGCAGCGGCGCACCGGGCGAAGACTCGGGCGCCATGGCACCCGCCGCCAT
GGGCAAGGGCGATGCGCTCAAGAAGTTCGCGGTCGACCTCACCGAGAAGGCCAGGAAGGGCGAGATGGAC
CCGATCACCGGGCGCGACGAGGAGATCCGCCAGATCGTCGACATCCTGATGCGCCGCCGCCAGAACAATC
CGCTGCTGACGGGCGAGGCCGGCGTCGGCAAGACGGCCGTGGTCGAAGGTTTCGCGCAGCGGCTCGCACG
CGGCGACGTGCCGCCGCAGCTGAAGGACGTGAAGCTGCTCACGCTCGACATCGGCCTGCTGCAGGCCGGC
GCCAGCATGAAGGGCGAGTTCGAGCAGCGCCTGCGCCAGGTGATCGACGAGGTGCAGAGCTCGCCGACGC
CCATCATTCTCTTCATCGACGAGATCCACACGCTCGTGGGTGCGGGCGGCGCGGCCGGCACCGGCGATGC
GGCCAACCTGCTGAAGCCGGCGCTGGCGCGCGGCAACCTGCGCACCATCGGCGCCACCACCTGGGCCGAG
TACAAGAAGTACATCGAGAAAGACCCGGCGCTGACAAGGCGCTTCCAGGTCGTGCAGGTGCCCGAGCCCG
ACGAGGTGAAGGCCATCCTGATGCTGCGCGGCGTGGCCAGCGTGCTCGAGAAGCACCACCGCGTGCAGCT
GCTCGACGAGGCCATCGAGGCGGCCGTGAAGCTGAGCCACCGCTACATTCCCGCGCGCCAATTGCCCGAC
AAGGCCGTGAGCCTGCTCGACACGGCGTGCGCGCGCGTGGCCGTGTCGCAGCACGCCACGCCGCCCGAGG
TGGAGGACTGCATGCGCCGCATCGAGGGGCTCACGGTCGAGCAGGAGATCATCGGCCGCGAGGAAGCCAT
CGGCATCGACGTGACCAAGCGCGCGGTGCAGGTGGCGGCGCTGCTGCTGGAATCGAATGGGCAGCTGGAA
ACGCTCAACGCCCGCTGGAAGGAAGAGAAGGGGCTGGTCGATCGGTTGCTCGAATTGCGTGCGAAGCTGC
GGGCGGGGAACAAGCCGGTGGATGCGGCGTCCACCGAGGGTGAGGCGAAGGCCGACGTGCCCCCACCCCA
ACCCTCTCCCGGCGGGGGAGGGAGCGAAGACCGGGCCGCGCTGCTCGAAGAGCTGCATGCGCTGCAGGCC
AAGATCCATGCGGTGCAGGGCGAATCGCCGCTGATCCTGCCTTCGGTCGACGAGCAGGCCGTGGCCTCGG
TGGTGGCCGACTGGACCGGCATTCCCGTCGGCCGCATGGTCAAGAACGAAGTCGAGGCGGTGCTCAAGCT
CGCCGACACGCTCAACCAGCGCGTCATCGGCCAGAAGCACGGCCTGGAGATGATCGCGCGGCGCATTCAA
ACGTCTCGCGCGCGGCTGGACAACCCGCAAAAGCCGATCGGCGTGTTCATGCTGTGCGGCACCTCGGGCG
TGGGCAAGACCGAGACCGCACTGGCACTGGCCGAGGCCCTGTACGGCGGCGAGCAGAACATCATCACCAT
CAACATGAGCGAATTCCAGGAGGCGCATACCGTCTCCACGCTCAAGGGCGCGCCGCCAGGCTACGTGGGC
TACGGCGAAGGCGGCATCCTGACCGAGGCCGTGCGCCGCCGGCCCTACAGCGTGGTGCTGCTCGACGAGG
TCGAGAAAGCCCACCCCGACGTGCACGAGATCTTCTTCCAGGTGTTCGACAAGGGCTGGATGGAAGACGG
CGAGGGCCGCATGATCGATTTCAAGAACACGATCATCCTGCTCACCACCAACGCCGGCAGCGAGCTCGTG
ATGAGCATGTGCCGCGACCCCGAGCTGCTGCCCGATTCGAACGCACTGGCCGATGCGCTGAAGGCGCCGC
TCATGAAAGTGTTCCCACCTGCGCTGCTGGGCCGCATCGTCACCATTCCCTACTACCCGCTCTCGCCGGA
CATGATGAAGAAGATCGTGCGGCTGCAGCTGGGCCGCATCAAGAAGCGCGTGGAGACCAACCACGGCGTG
CCCTTCGAGTACAGCGACGCGGTGGTCGACCAGGTGGTTGCGCGCTGCCAGGATCCGGAGTCGGGCGGGC
GCGTGATCGACGCGATCCTGACCAACACGGTGCTGCCAACGATTTCTGTCGAGTACCTGCAGCGGCTGGC
CTCGGGCGGCGAGATCCGCCGCGTCGCGCTGGATGTGAAGGATGCCGACTTCACCTACGCATTCGACTGA
 Primer design