SecReT6
Protein ID: 538392843
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06130
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]677885..680263 [+]
Productputative type VI secretion system protein, Vgr family
NoteTssI
UniProt IDT1X575
KEGG IDvpd:VAPA_1c06130
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.00E-56, Aligned region: 27..332
Phage_base_V [PF04717], Evalue: 3.00E-26, Aligned region: 415..506
Gp5_C [PF06715], Evalue: 1.50E-21, Aligned region: 557..571
Gp5_C [PF06715], Evalue: 1.50E-21, Aligned region: 557..576
Gp5_C [PF06715], Evalue: 1.50E-21, Aligned region: 572..594
Gp5_C [PF06715], Evalue: 1.50E-21, Aligned region: 596..619
Gp5_C [PF06715], Evalue: 1.50E-21, Aligned region: 621..642
Gp5_C [PF06715], Evalue: 1.50E-21, Aligned region: 646..667
Gp5_C [PF06715], Evalue: 1.50E-21, Aligned region: 672..691
Gp5_C [PF06715], Evalue: 1.50E-21, Aligned region: 690..707
Gp5_C [PF06715], Evalue: 1.50E-21, Aligned region: 708..730
Protein Sequence: 792 a.a.     [Download]
>gi|538392843|ref|YP_008514416.1| putative type VI secretion system protein, Vgr family [Variovorax paradoxus B4]
MADHEFRIESDSPANGELMFWRIVGHEALARASSYELTVLSKNHALDAKDILGRAFDLVIQFQDKDGGMH
ERHCQGHAVRFERTGHVGRHFEYRIGLRSWFWLLTKRINSRILQDKKVLEVLDAVFEDSPIKRFKKTRAS
NVIGTHNPRRYCVQHQESDYQFLSRLLEDEGIYYWFDAHDAPGTMHLSDASDMAHDKLPVEGTLRHVATD
TTEARHNEISRWVSARQFDTGTYASCDSDFKAIKKKLEAAGGQPDKHELGEFEAFEFAGGYFTGGDADDK
GKLRGEEIVARRQRHWALTTWPDVAAGRSFTFEGDPDGTRDGDYVIAACIFAASHPGYESIPHATPRMPI
EQALREALDDDAVNAQARPALEALIADAPALRTDPQGTSAFLITALPVDVPFRPPRLTPRVVMPGPQSAI
VVGPDGEEIHADDFGRVKVHFHWDRYDKSDEKSTCWVRVSQPWAGKGWGGYFIPRIGQEVIVDFLNGDPD
RPIIVGRVYNDDQPIPFGSHTQSGFRTRSTPKGSASNCNEFRFEDKKGSEQVYLHAEKNQDIEVENDETH
WVGHDRTKTIDHDETTHVKHDRTETVDNNETIAVHGQRTETVDKDETITIHQNRTETVDLNETISIGQNR
TITVGASETATVALQRTHSVGINETITVGAAQEITVGAMQAVTVGASQTINVGANQSSSIGANRSVDVGA
NLSTTVGADESRSVGAGRTTSVGKDDALTVGKNLVIDAGDSISITTGSASITMKKDGTIVIKGKDITIDA
SGKINAKASGNIVMKGSKILQN
 
Nucleotide Sequence: 2379 bp     [Download]
>gi|538392231|ref|NC_022247.1|:677885-680263 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGCTGATCACGAGTTCCGTATCGAAAGCGATTCGCCCGCCAACGGCGAGCTGATGTTCTGGCGCATCG
TCGGCCATGAGGCGCTCGCGCGCGCGTCGAGCTACGAACTCACCGTGCTGTCGAAGAACCATGCGCTCGA
CGCCAAGGACATCCTGGGCCGCGCCTTCGACCTGGTCATCCAGTTCCAGGACAAGGACGGCGGCATGCAC
GAGCGCCACTGCCAGGGCCATGCGGTGCGCTTCGAGCGCACGGGCCACGTGGGGCGGCACTTCGAATACC
GCATCGGGCTGCGCTCGTGGTTCTGGCTGCTCACCAAGCGTATCAACTCGCGCATCCTGCAGGACAAGAA
GGTGCTCGAAGTGCTCGACGCGGTGTTCGAGGACAGCCCGATCAAGCGCTTCAAGAAGACCAGGGCGAGC
AACGTGATCGGCACGCACAACCCGCGGCGCTATTGCGTGCAGCACCAGGAGAGCGACTACCAGTTCCTGT
CGCGCCTGCTGGAAGACGAAGGTATCTACTACTGGTTCGACGCGCACGATGCGCCGGGCACCATGCATCT
TTCGGACGCCAGCGACATGGCGCACGACAAGCTGCCGGTCGAAGGCACCCTGCGCCATGTGGCCACCGAC
ACCACCGAGGCGCGCCACAACGAGATCTCGCGCTGGGTGAGCGCGCGGCAGTTCGACACCGGCACCTACG
CCTCGTGCGACAGCGACTTCAAGGCGATCAAGAAGAAACTCGAGGCCGCGGGCGGCCAGCCCGACAAGCA
CGAGCTGGGCGAATTCGAAGCCTTCGAATTTGCCGGCGGCTACTTCACGGGCGGGGATGCGGACGACAAG
GGCAAGCTGCGCGGCGAGGAGATCGTCGCGCGCCGCCAGCGCCACTGGGCGCTCACCACCTGGCCCGACG
TGGCGGCGGGACGCAGCTTCACCTTCGAGGGGGACCCCGACGGCACGCGGGATGGCGACTACGTGATCGC
GGCCTGCATCTTCGCGGCGAGCCACCCCGGCTACGAGAGCATTCCCCATGCCACGCCGAGGATGCCCATC
GAGCAGGCGCTGCGCGAGGCGCTCGACGACGACGCCGTGAACGCCCAGGCGCGGCCCGCGCTCGAGGCAC
TGATCGCCGACGCACCCGCGCTGCGCACCGACCCGCAGGGCACCAGCGCCTTCCTGATCACCGCGCTGCC
GGTCGACGTGCCGTTCCGTCCGCCGCGGCTCACACCGCGCGTGGTGATGCCAGGGCCGCAGTCGGCCATC
GTGGTGGGGCCGGACGGCGAAGAGATCCACGCCGACGACTTCGGCCGCGTGAAGGTGCACTTCCACTGGG
ACCGCTACGACAAGAGCGACGAGAAGTCGACCTGCTGGGTGCGCGTGTCGCAGCCGTGGGCAGGCAAGGG
CTGGGGCGGGTACTTCATTCCGCGCATCGGGCAGGAGGTGATCGTCGACTTCCTGAACGGCGACCCCGAC
CGGCCGATCATCGTGGGCCGCGTCTACAACGACGATCAGCCGATCCCGTTCGGCTCGCACACGCAGAGCG
GCTTTCGCACGCGCTCCACGCCCAAGGGCAGCGCCTCGAACTGCAACGAGTTCCGCTTCGAGGACAAGAA
GGGGTCGGAGCAGGTGTACCTGCACGCCGAGAAGAACCAGGACATCGAGGTCGAAAACGACGAGACCCAT
TGGGTGGGCCACGACCGCACCAAGACCATCGACCACGACGAGACCACGCACGTCAAGCACGACCGCACCG
AGACGGTGGACAACAACGAGACCATCGCCGTGCACGGCCAGCGCACCGAGACGGTGGACAAGGACGAGAC
CATCACGATCCACCAGAACCGCACGGAGACGGTGGACCTGAACGAGACGATCTCCATCGGCCAGAACCGC
ACGATCACGGTGGGCGCGAGCGAGACGGCGACCGTGGCGCTGCAGCGCACGCATTCGGTGGGGATCAACG
AGACCATCACCGTCGGCGCAGCGCAGGAGATCACGGTGGGGGCGATGCAGGCGGTGACGGTGGGGGCGAG
CCAGACGATCAATGTGGGGGCGAACCAGTCGAGCAGCATCGGGGCGAACCGGTCGGTGGATGTGGGGGCG
AATCTGTCGACCACCGTGGGCGCCGATGAATCGCGCAGCGTGGGCGCGGGCCGCACGACCAGCGTGGGGA
AGGACGATGCGCTCACCGTCGGCAAGAACCTCGTGATCGACGCGGGCGACTCCATCTCGATCACCACCGG
CAGCGCGAGCATCACGATGAAGAAGGACGGGACCATCGTCATCAAGGGCAAGGACATCACGATCGACGCC
TCCGGGAAGATCAACGCGAAGGCGAGCGGCAATATCGTGATGAAGGGCTCGAAGATTCTGCAGAACTGA
 Primer design