SecReT6
Protein ID: 538392850
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06200
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]686651..688327 [+]
Productputative type VI secretion system protein, FHA domain-containing
NoteFha
UniProt IDT1X6G3
KEGG IDvpd:VAPA_1c06200
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.80E-12, Aligned region: 28..94
Protein Sequence: 558 a.a.     [Download]
>gi|538392850|ref|YP_008514423.1| putative type VI secretion system protein, FHA domain-containing [Variovorax paradoxus B4]
MIHIAVITRQGAPAGQPIAADFGPNGGTIGRADTNTLVLDDPDRTVSRVHAQVLCRDGQYFVIDRGSNPM
QCNGVSLGSGKEAALTDGARLVVGSFELSVRMSAAAPPALAIPNTVMSAPLGAAPASSTSDDPFADLLAG
LGSPAPAAPAAAGASRARAPAPASADPLLFPDPMESGSRNAQAAQVDPFANLLGPTPSSAPAAGLGALDD
FSDLGAPPAHGRAAGIDELFGGMGGGGGIGGDPLALSPLADPLLQPNTASSADPLAALQSAAPSTPTPRS
DHLPIDQFGFTPPKAITPPPPPAPEPAAAPAEALPRFDDITGQPIRISGPEVASRPFEPLPPPPPPPPVQ
RAPAAVPRTASDDELLAAFLRGLASTHQAPEMLTPGLMERIGSILRSATEGTLQLLLTRQEFKREVRAEV
TMIAAQANNPLKFSPTVEVALAHLLGPGVRGFMPPEAAMRDAFNDLRAHQFGVMVGMRAALAHVIARFEP
EELEKKISARSALDALFSANRKAKLWDQFVALYGGIASEAEDDFHNLFGKAFLEAYEEQMARLKSDGQ
 
Nucleotide Sequence: 1677 bp     [Download]
>gi|538392231|ref|NC_022247.1|:686651-688327 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGATCCATATCGCTGTCATCACCCGGCAAGGCGCTCCGGCGGGGCAGCCCATCGCCGCCGATTTCGGGC
CCAACGGGGGCACCATCGGACGCGCCGACACCAACACGCTGGTGCTCGACGACCCGGACCGGACGGTCTC
GCGCGTGCACGCCCAGGTGCTGTGCCGCGATGGGCAGTACTTCGTCATCGACCGCGGCAGCAATCCGATG
CAGTGCAACGGCGTATCGTTGGGCTCGGGCAAGGAGGCAGCGCTCACCGATGGCGCGCGGCTGGTCGTGG
GCAGCTTCGAGCTCAGTGTGCGCATGAGCGCGGCAGCGCCACCGGCATTGGCCATTCCCAACACCGTGAT
GTCGGCACCGCTCGGCGCAGCCCCCGCGTCCAGCACCAGCGACGATCCCTTTGCCGACCTGCTTGCGGGG
CTCGGATCGCCTGCGCCAGCCGCGCCCGCCGCGGCCGGCGCATCCCGTGCCAGGGCCCCCGCGCCCGCGA
GCGCGGATCCGCTGCTCTTTCCCGACCCGATGGAAAGCGGCTCGCGCAACGCGCAGGCCGCGCAGGTCGA
TCCGTTCGCCAACCTGCTCGGGCCCACGCCGTCCTCTGCGCCGGCCGCAGGTCTCGGTGCGCTCGACGAT
TTCTCCGACCTCGGCGCGCCGCCCGCGCACGGCAGGGCGGCCGGCATCGACGAGCTCTTCGGCGGCATGG
GCGGTGGCGGCGGCATCGGCGGCGACCCGCTCGCGCTGTCGCCGCTGGCCGATCCGCTGCTGCAGCCGAA
CACGGCTTCTTCGGCCGATCCGCTGGCTGCATTGCAGAGCGCGGCGCCGTCCACGCCGACGCCGCGCTCC
GACCACCTGCCGATCGACCAGTTCGGCTTCACGCCGCCGAAGGCGATCACGCCGCCACCGCCGCCCGCAC
CAGAACCGGCCGCCGCGCCGGCGGAAGCGTTGCCGCGGTTCGACGACATCACGGGCCAGCCGATACGCAT
CAGCGGCCCCGAGGTCGCCAGCCGGCCGTTCGAGCCGCTGCCGCCACCACCGCCACCGCCCCCCGTCCAG
AGGGCGCCCGCCGCGGTCCCGCGCACCGCCTCCGACGACGAGCTGCTCGCCGCTTTCCTGCGCGGCCTCG
CCAGCACGCACCAGGCGCCCGAGATGCTCACGCCCGGCCTCATGGAGCGCATCGGATCCATCCTGCGCAG
CGCCACCGAGGGCACGCTGCAGCTGCTGCTCACGCGCCAGGAATTCAAGCGCGAGGTGCGCGCCGAGGTC
ACGATGATCGCGGCGCAGGCCAACAACCCGCTCAAGTTCTCGCCCACGGTGGAGGTGGCGCTCGCGCACC
TGCTCGGGCCCGGCGTGCGCGGCTTCATGCCCCCGGAGGCCGCGATGCGCGATGCCTTCAACGACCTGCG
CGCCCACCAGTTCGGCGTGATGGTGGGCATGCGCGCGGCGCTGGCCCATGTCATTGCGCGCTTCGAGCCC
GAAGAGCTCGAGAAGAAGATCAGCGCAAGGTCGGCGCTCGACGCACTCTTCAGCGCCAACCGCAAGGCCA
AGCTCTGGGACCAGTTCGTCGCGCTCTACGGCGGCATCGCGAGCGAGGCGGAAGACGATTTCCACAACCT
CTTCGGCAAGGCCTTCCTCGAGGCCTACGAAGAGCAAATGGCGCGCCTCAAGTCCGACGGACAGTGA
 Primer design