SecReT6
Protein ID: 538392854
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06240
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]690461..690943 [-]
Productputative type VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDT1X5Z2
KEGG IDvpd:VAPA_1c06240
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.10E-41, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|538392854|ref|YP_008514427.1| putative type VI secretion system effector, Hcp1 family [Variovorax paradoxus B4]
MAADMFLKLEGVDGESKDDSHKKEIDVLSWSWGASQSGTGHVGGGSGAGKVSVQDLSVTKYVDASSHLLL
LDCCNGQHIKKGTLVVRKAGATPLEYVKLTMEDIIVSNIHTGGSGGEDRLTETITLNFSKFKYEYTPQKA
DGSGDGTKETGWDIAANKKV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|538392231|ref|NC_022247.1|:c690943-690461 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGCTGCAGACATGTTTTTGAAGCTCGAAGGCGTCGACGGTGAATCCAAGGACGATTCGCACAAGAAGG
AAATCGACGTTCTCTCCTGGAGCTGGGGTGCCAGCCAGTCCGGCACCGGCCACGTCGGCGGCGGCTCGGG
CGCCGGCAAGGTGAGCGTGCAGGACCTCTCGGTCACCAAGTATGTGGATGCCTCCTCGCACCTGCTGCTG
CTCGACTGCTGCAACGGCCAGCACATCAAGAAGGGCACGCTGGTGGTCCGCAAGGCCGGAGCCACGCCGC
TCGAGTACGTCAAGCTCACGATGGAAGACATCATCGTCAGCAACATCCACACCGGCGGCAGCGGCGGCGA
AGACCGCCTGACCGAAACCATCACGCTGAACTTCTCGAAGTTCAAGTACGAGTACACGCCGCAGAAGGCC
GACGGCTCCGGCGACGGCACCAAGGAAACCGGCTGGGACATCGCCGCCAACAAGAAGGTCTGA
 Primer design