SecReT6
Protein ID: 538392855
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06250
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]691087..692580 [-]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDT1X6G9
KEGG IDvpd:VAPA_1c06250
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.80E-192, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|538392855|ref|YP_008514428.1| type VI secretion protein, EvpB/VC_A0108 family [Variovorax paradoxus B4]
MAEALEQSALKDVAYAGSDFSSLLQKEFKPRSDEAKSAVEAAVLTLAQQALSNSTVIGKDVTKSIQSMIA
AIDAKLTDQVNKIIHHPDYQKLESAWRGLHYMVNNTETDEHLKIRVMDISKTDLAKSLKKFKGAAWDQSP
MFKKIYEQEYGQFGGEPFGALVGDYHFDQSPPDIELLGEMSKIAASAHAPFITGASPNLMQMESWQELAN
PRDLTKIFLTPEYAGWRSLRDSDDAKYLGLCMPRFLARTPYGANTNPVEEFDFEEDTAGADHSKYAWANA
AYAMATNINRSYKLYGWGSRIRGIESGGAVENLPLHTFPSDDGGVDQKCPTEIAISDRREAELSKAGLLS
LIHRKNSDFAAFIGAQSLHKPAEYDDPDATANANLAARLPYLFACNRFAHYLKCIVRDKVGSFKERDDMQ
RWLNKWIMNYVDGDPVNSSEETKARKPLAAAEVVVEEVEGNPGYYTSKFFLRPHYQLEGLTVSLRLVSKL
PSAKGGK
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|538392231|ref|NC_022247.1|:c692580-691087 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGCCGAAGCACTCGAGCAGAGCGCACTCAAGGATGTCGCCTATGCGGGCAGCGATTTTTCGTCGCTCC
TGCAGAAGGAATTCAAGCCGCGCAGCGACGAAGCCAAGAGCGCCGTCGAAGCCGCGGTGCTCACGCTCGC
GCAGCAGGCGCTGAGCAACAGCACCGTCATTGGCAAGGACGTGACCAAGTCGATCCAGTCGATGATCGCC
GCGATCGACGCCAAGCTGACCGACCAGGTCAACAAGATCATCCACCACCCCGACTACCAGAAGCTCGAGA
GTGCGTGGCGCGGCCTGCACTACATGGTGAACAACACCGAGACCGACGAGCACCTGAAGATCCGGGTGAT
GGACATCTCGAAGACGGACCTCGCCAAGAGCCTGAAGAAGTTCAAGGGCGCGGCCTGGGACCAGAGCCCG
ATGTTCAAGAAGATCTACGAGCAGGAATACGGCCAGTTCGGCGGCGAGCCCTTCGGCGCGCTGGTGGGCG
ACTACCACTTCGACCAGAGCCCGCCCGACATCGAGCTGCTCGGCGAGATGTCCAAGATCGCGGCTTCGGC
GCATGCACCCTTCATCACCGGCGCGAGCCCCAACCTGATGCAGATGGAATCGTGGCAGGAGCTCGCCAAC
CCGCGCGACCTGACCAAGATCTTCCTCACGCCCGAGTACGCCGGCTGGCGGTCGCTGCGCGACTCCGACG
ACGCCAAGTACCTGGGCCTGTGCATGCCGCGCTTCCTCGCGCGCACGCCCTACGGCGCCAACACCAATCC
GGTGGAGGAGTTCGACTTCGAGGAAGACACCGCCGGTGCCGACCACAGCAAGTACGCCTGGGCCAACGCA
GCCTATGCGATGGCCACCAACATCAACCGCTCCTACAAGCTCTACGGCTGGGGTTCGCGCATCCGCGGCA
TCGAGTCGGGCGGCGCGGTGGAGAACCTGCCGCTGCACACCTTCCCGAGCGACGACGGCGGCGTGGACCA
GAAGTGCCCGACCGAGATCGCCATCAGCGACCGGCGCGAGGCGGAACTGTCGAAGGCCGGCCTGCTCTCG
CTGATCCACCGCAAGAACTCCGACTTCGCGGCCTTCATCGGTGCGCAGTCGCTGCACAAGCCGGCCGAGT
ACGACGACCCGGATGCCACGGCCAATGCCAATCTTGCGGCGCGCCTGCCCTACCTCTTTGCCTGCAACCG
CTTCGCGCACTACCTCAAGTGCATCGTGCGCGACAAGGTCGGCAGCTTCAAAGAGCGCGACGACATGCAG
CGCTGGCTCAACAAGTGGATCATGAACTACGTGGACGGCGACCCCGTCAACTCCTCTGAAGAGACCAAGG
CCAGAAAGCCCCTGGCCGCTGCCGAGGTGGTGGTGGAAGAGGTCGAGGGCAACCCCGGCTACTACACCTC
GAAGTTCTTCCTGCGCCCGCACTACCAGCTCGAAGGCCTCACGGTGTCGCTGCGGCTGGTGTCGAAGCTG
CCCTCGGCCAAGGGCGGCAAGTAA
 Primer design