SecReT6
Protein ID: 538392856
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06260
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]692621..693139 [-]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDT1X5N2
KEGG IDvpd:VAPA_1c06260
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.50E-60, Aligned region: 9..162
Protein Sequence: 172 a.a.     [Download]
>gi|538392856|ref|YP_008514429.1| type VI secretion protein, VC_A0107 family [Variovorax paradoxus B4]
MAKSSQKFIARNRAPRVQIEYDVELYGAEKKIQLPFVMGVLADLSGKPADPLAPVADRKFLEFDVDNFDS
RMKAMKPRAAFAVENSLTGEGELKVELTFENMEDFSPAAVARKVGALDKLLEARTQLSNLVTYMDGKNGA
EELLAKVLEDPALLQSLAATAKPDDEAAKPAA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|538392231|ref|NC_022247.1|:c693139-692621 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGCCAAGAGCAGTCAGAAATTCATCGCCCGCAACCGGGCGCCACGCGTGCAGATCGAATACGACGTGG
AACTCTACGGCGCCGAGAAGAAGATCCAGCTGCCCTTCGTGATGGGCGTGCTGGCCGACCTGTCGGGCAA
GCCGGCCGATCCGCTCGCGCCCGTGGCCGACCGCAAGTTCCTCGAGTTCGACGTCGACAACTTCGACTCG
CGCATGAAGGCCATGAAGCCGCGCGCCGCCTTCGCGGTGGAGAACTCGCTCACCGGCGAAGGCGAACTCA
AGGTCGAGCTCACCTTCGAGAACATGGAAGACTTCTCGCCCGCCGCCGTGGCCAGGAAGGTCGGCGCGCT
CGACAAGCTGCTCGAGGCGCGCACCCAGCTGTCGAACCTCGTGACCTACATGGACGGCAAGAACGGCGCC
GAGGAACTGCTGGCCAAGGTGCTCGAAGACCCGGCCCTGCTGCAGTCGCTGGCGGCCACCGCCAAGCCCG
ACGACGAAGCGGCCAAGCCGGCCGCCTGA
 Primer design